KEGG   Clostridium botulinum B1 Okra: CLD_3366Help
Entry
CLD_3366          CDS       T00671                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbb00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1333473..1334918
Genome map
AA seq 481 aa AA seqDB search
MKTNFPENFLWGGAVAANQCEGAYNIDGKGLSVQDVAPKGIKAGPTLEPTQDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRLSIAWSRIFPMGDEKEANEKGLQFYDDVFDECLKYDIQP
IVTLSHYETPLHLSKVYDGWKSREMIRFFNKYACTVFNRYKNKVKYWLTFNEINSITHAP
FLSGGIYTPIEKLSKQEIYQAIHHELVASAMAVKACHEIIPDAKIGCMILGMPVYPLKPS
PEDMWDTLNKERENFFFSDIQVRGYYPSYSKRFFKENNIKLDITNKDIEILRNTVDFISF
SYYMSICESSDKSIKAGEGNIIGGIPNPYLKASEWGWQIDPKGLRYYLNILYDRYQKPLF
IVENGLGAVDELVELEDGTKTVLDDYRISYLRDHLIQVSEAIEDGVNLMGYTSWGCIDLV
SFTTSELKKRYGFIYVDRNDDGTGTLERYKKKSFYWYKEVISSNGDIEALCSNINIEKDK
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaattttccagaaaattttttatggggtggtgcagttgcagctaaccaatgt
gaaggagcttataatattgatggtaaaggattaagcgtgcaagatgtagcgccaaaggga
ataaaagctggtcctacattagagcctacacaagataatatgaaacttataggtatagat
ttttatcatagatataaagaagatattaagctttttgcagaaatgggatttaaggttttt
agattatcaattgcttggtcaagaatattcccaatgggggatgaaaaagaagcaaatgag
aaaggactacaattttatgatgatgtttttgatgaatgcttaaagtatgacatacagcca
atagtaacattgtcccattatgaaacaccattgcatttatctaaagtttacgatggatgg
aaaagtcgtgagatgattagattttttaataagtatgcttgtacagtttttaatcgatat
aaaaataaagtaaaatattggttaacttttaatgaaattaattcaattactcatgcacca
tttttaagtggtggaatctatacaccaatagaaaaattaagtaagcaagagatttatcaa
gctattcatcatgaattagtagcaagtgcaatggcagtaaaagcatgtcatgaaattatt
cctgatgctaaaataggatgtatgattttggggatgcctgtatatccattgaaaccatca
ccagaagatatgtgggatactcttaataaagaaagagagaattttttcttttcagatatt
caagtccgtggttattatccctcatattcaaaaagattctttaaagaaaataatattaag
ttagatattacaaataaagatatagaaatattaagaaatactgtagattttatttcattt
agctattatatgagtatttgtgaatctagcgataaatctattaaggcaggtgagggaaat
attattggagggatacctaatccttatttaaaagcaagtgaatggggatggcaaattgat
cctaaaggactaaggtattatcttaatatattgtatgatcgttatcaaaagccattgttt
atagttgaaaatggattaggagctgtagatgaattagttgagctagaagatggaacaaaa
acagtattagatgactatagaatttcatatttaagagatcatttaattcaagtatcagaa
gcaatcgaggatggagtgaacttaatgggatatacttcttggggatgcattgatctggtt
agttttaccacttctgaattaaaaaaacgttatggatttatttatgtagatcgtaatgat
gatggaacagggacattagaacgttataagaaaaaaagcttttactggtataaagaagta
atttcaagtaatggagatattgaagcactatgctcaaatattaatattgaaaaagataaa
atataa

DBGET integrated database retrieval system