KEGG   Clostridium botulinum B1 Okra: CLD_3368Help
Entry
CLD_3368          CDS       T00671                                 

Definition
O-glycosyl hydrolase, family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1331138..1332466
Genome map
AA seq 442 aa AA seqDB search
MKFIHYKTTKKDKFLKNEINNTTDGRPTLHVSQVENRVIEGFGSCFNELGMKALHHLDKD
ERNKVLDQLFSTKGDCRFKLCRMPIGASDYATEWYSYNENENDFDMEKFSIEKDKRLLIP
YIKEALKRNPNIILTASPWSPPTWMKTQKAYNFGTLRFEEKILKAYALYFVKFVQAYEEE
GITIHQVHVQNEVVADQKFPSCRWTGEQLRDFIKNYLGPAFEKYNIKSEIWLGTINAPEP
YVEWLEDYTQDFDVYAGLVLRDPKAYKYVKGIGYQWAGKNAIQRSVEAFPEKRFIQTENE
CGNGKNTWIYAEYVFNLFRHYIVNGVNGYMYWNAVLEPKGMSTWGWEQNSMIIVNPETKE
VMYNPEFYVMKHFSHFVQKGAKRLTTSGVDSVDTVAFKNPDESIIIVISNKNDNPRIANI
EFAGEIFEVELEEHSFNTIVLE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatacattataaaactactaaaaaagataaatttttaaaaaatgaaattaat
aatactacagatggaagaccaacattgcacgtttcacaagttgaaaatagggtcatagag
ggatttggaagttgttttaacgagttagggatgaaagcattacatcacttagacaaagat
gaaagaaataaagtacttgatcaactattttctactaaaggtgattgtcgttttaagctt
tgcagaatgcctattggagcaagtgattatgcaacagaatggtatagctataacgaaaat
gaaaacgattttgatatggagaagtttagtattgaaaaggataaaagacttcttatacct
tatataaaagaagcattaaaaagaaatcctaatataattctaacagcttctccatggagt
cctccaacttggatgaaaacacagaaggcttacaattttggaactttacgctttgaagag
aaaattttaaaggcatatgctctttattttgttaaatttgtacaagcatatgaggaagaa
ggaataacaattcatcaagttcatgttcagaatgaagttgttgcagatcaaaaattccca
tcttgtagatggacaggagagcaattgagagattttattaaaaattatttagggccagcc
tttgaaaagtataatattaagagtgaaatttggttaggaacaattaatgcgccagagcct
tatgttgaatggttagaagattatacacaagattttgatgtttatgctggcttagtattg
agagatccaaaagcatataagtatgttaaagggataggatatcaatgggcaggaaaaaat
gctattcagcgttcagttgaagcatttccagaaaaaagatttatccaaactgaaaatgag
tgcggtaatggtaaaaatacatggatatatgcagaatatgtttttaatttattcagacat
tatattgtaaatggtgtaaatggatatatgtattggaatgctgttttggaaccaaaagga
atgagtacttggggatgggaacagaattctatgataattgtgaatccagaaactaaagaa
gttatgtataatccagagttctatgtaatgaaacatttttctcattttgttcaaaaaggg
gcaaaaagattaactacttcaggtgtagattctgttgatacagtagcttttaagaatcca
gatgaatctataattattgtaatttcaaataaaaatgataatcctagaattgctaatatt
gaatttgcaggtgaaatatttgaagttgaattagaagaacattcatttaacactattgtt
ttggaataa

DBGET integrated database retrieval system