KEGG   Clostridium botulinum B1 Okra: CLD_3368Help
Entry
CLD_3368          CDS       T00671                                 

Definition
O-glycosyl hydrolase, family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CLD_3368
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CLD_3368
Enzymes [BR:cbb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CLD_3368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1331138..1332466
Genome map
AA seq 442 aa AA seqDB search
MKFIHYKTTKKDKFLKNEINNTTDGRPTLHVSQVENRVIEGFGSCFNELGMKALHHLDKD
ERNKVLDQLFSTKGDCRFKLCRMPIGASDYATEWYSYNENENDFDMEKFSIEKDKRLLIP
YIKEALKRNPNIILTASPWSPPTWMKTQKAYNFGTLRFEEKILKAYALYFVKFVQAYEEE
GITIHQVHVQNEVVADQKFPSCRWTGEQLRDFIKNYLGPAFEKYNIKSEIWLGTINAPEP
YVEWLEDYTQDFDVYAGLVLRDPKAYKYVKGIGYQWAGKNAIQRSVEAFPEKRFIQTENE
CGNGKNTWIYAEYVFNLFRHYIVNGVNGYMYWNAVLEPKGMSTWGWEQNSMIIVNPETKE
VMYNPEFYVMKHFSHFVQKGAKRLTTSGVDSVDTVAFKNPDESIIIVISNKNDNPRIANI
EFAGEIFEVELEEHSFNTIVLE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatacattataaaactactaaaaaagataaatttttaaaaaatgaaattaat
aatactacagatggaagaccaacattgcacgtttcacaagttgaaaatagggtcatagag
ggatttggaagttgttttaacgagttagggatgaaagcattacatcacttagacaaagat
gaaagaaataaagtacttgatcaactattttctactaaaggtgattgtcgttttaagctt
tgcagaatgcctattggagcaagtgattatgcaacagaatggtatagctataacgaaaat
gaaaacgattttgatatggagaagtttagtattgaaaaggataaaagacttcttatacct
tatataaaagaagcattaaaaagaaatcctaatataattctaacagcttctccatggagt
cctccaacttggatgaaaacacagaaggcttacaattttggaactttacgctttgaagag
aaaattttaaaggcatatgctctttattttgttaaatttgtacaagcatatgaggaagaa
ggaataacaattcatcaagttcatgttcagaatgaagttgttgcagatcaaaaattccca
tcttgtagatggacaggagagcaattgagagattttattaaaaattatttagggccagcc
tttgaaaagtataatattaagagtgaaatttggttaggaacaattaatgcgccagagcct
tatgttgaatggttagaagattatacacaagattttgatgtttatgctggcttagtattg
agagatccaaaagcatataagtatgttaaagggataggatatcaatgggcaggaaaaaat
gctattcagcgttcagttgaagcatttccagaaaaaagatttatccaaactgaaaatgag
tgcggtaatggtaaaaatacatggatatatgcagaatatgtttttaatttattcagacat
tatattgtaaatggtgtaaatggatatatgtattggaatgctgttttggaaccaaaagga
atgagtacttggggatgggaacagaattctatgataattgtgaatccagaaactaaagaa
gttatgtataatccagagttctatgtaatgaaacatttttctcattttgttcaaaaaggg
gcaaaaagattaactacttcaggtgtagattctgttgatacagtagcttttaagaatcca
gatgaatctataattattgtaatttcaaataaaaatgataatcctagaattgctaatatt
gaatttgcaggtgaaatatttgaagttgaattagaagaacattcatttaacactattgtt
ttggaataa

DBGET integrated database retrieval system