KEGG   Clostridium botulinum B1 Okra: CLD_3429Help
Entry
CLD_3429          CDS       T00671                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cbb00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1264078..1264638
Genome map
AA seq 186 aa AA seqDB search
MFKSILIIDCQNDFISGSLACDNGEIAVKNIINLLNINKDLKVFYSLDWHSENNKSFKIN
GGIWPVHCVANRFGAKLEESFYKELQHKNHSPNNKKILFLKGKNDHIEEYSAYEGENILG
NKINEVLDKDVIVCGIASEFCVKETVEDLIRNGFNVELYIDGVAYVNKKEHEKTLNNLRE
QGAKFI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtcaatacttataatagactgccaaaatgatttcatatcaggttcactggct
tgtgataatggagagatagctgttaaaaacattataaatttattaaatataaataaagat
ttaaaagtattttactctttagattggcatagtgaaaataataaatcttttaaaataaat
ggtggtatatggccagtacattgtgtagccaatagatttggtgctaaactagaggagagt
ttttataaagaattacaacataaaaatcattcacctaataataaaaaaatattgttttta
aaaggaaaaaatgatcatatagaagaatattcagcctatgaaggagaaaatattttaggt
aataagattaatgaagtattagataaggatgtaattgtatgtggtatagcttctgagttt
tgtgttaaagaaacggtagaggacttaattagaaatggatttaatgtggaattatatata
gatggggtagcatatgtaaataaaaaagaacatgaaaaaactttaaataatttaagagag
cagggggctaaatttatttaa

DBGET integrated database retrieval system