KEGG   Clostridium botulinum B1 Okra: CLD_3636Help
Entry
CLD_3636          CDS       T00671                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLD_3636 (hemB)
Enzymes [BR:cbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CLD_3636 (hemB)
Exosome [BR:cbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLD_3636 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1043394..1044368
Genome map
AA seq 324 aa AA seqDB search
MFRRHRRLRENEAIRAMVRETVIREEDFIYPMFVVEGENIKEEISSLPGNYHYSIDRLEE
LVEEVKKSGIKGIMIFGVPDHKDECGSAAFDDNGIVQKGIRRLRELMPELYIVADVCMCQ
YTSHGHCGIIHGHNVDNDESLKYLAKISLSYAKAGADMIAPSDMMDGRVYAIRKILDENN
FKHVGIMAYSAKYCSAFYGPFREAANSAPQFGDRKTYQMDPANGREAMLEIEDDINEGAD
IVMVKPALPYLDVIRMAKDRFEFPLAAYNVSGEYAMVKAAAKQGLIDERRVALEMLTSIK
RAGADIIITYYAFEASAWLKEDRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagacacagaagattaagagagaatgaagcaataagagctatggtaagagaa
acagtgattagagaagaggattttatatatccaatgtttgtggtagaaggagaaaatatt
aaagaagaaatatcttcactgccaggaaattatcattattctatagatagattagaagaa
ttagtagaagaagtaaagaaatcaggcataaaaggcataatgatatttggagtaccagat
cataaagatgaatgtggctctgcagcctttgatgataatggaatagttcaaaagggtata
agaagattaagagaattaatgccagaactatatatagttgcagatgtatgtatgtgccaa
tatacaagtcatgggcattgcggaataattcatggtcataatgtagataatgatgaatca
ttgaaatatttagcaaaaatatctttatcctatgcaaaagctggagcagatatgatagca
ccttcagatatgatggatggaagagtttatgctataagaaaaatattagatgaaaataat
tttaaacatgtaggcataatggcttatagtgcaaaatattgttcagctttctatggccct
ttcagagaagcagccaattcagcaccacaatttggagacagaaaaacttatcaaatggat
ccagcaaacggaagagaagcaatgcttgaaatagaagacgatataaatgaaggtgcagat
atagtaatggtaaaaccagctctaccatacttagatgttataagaatggcaaaggataga
tttgaattcccgttagcagcttacaatgtaagtggagaatatgctatggtaaaagcagca
gctaaacaaggattaatagatgaaagaagagtagccctagaaatgctaacatcaataaaa
agagcaggagcagatataataataacttattatgcatttgaagcaagtgcttggctaaaa
gaagacagaaaatag

DBGET integrated database retrieval system