KEGG   Clostridium botulinum B1 Okra: CLD_3742Help
Entry
CLD_3742          CDS       T00671                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CLD_3742 (folK)
Enzymes [BR:cbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CLD_3742 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
940893..941348
Genome map
AA seq 151 aa AA seqDB search
MHTAYVAFGSNIGEKENYIKRALEKIEERGMKIIKVSSIYETEPYGVLDQDSFLNGVVKI
ETNLTPEDLIGELLHIEKQLDRVRERRWGPRTIDLDIIFYDDLIINEKDLVIPHKDMENR
EFVLKPLCDIDENFIHPVLKKSVRELYDRLK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgcatacagcttatgtggcctttggtagtaatataggtgaaaaagaaaattacataaaa
agggcattggaaaagatagaagaaagaggaatgaaaataattaaagtatcctctatatat
gaaacagaaccctatggagtattagatcaagatagttttttaaatggagtagtaaaaata
gaaactaatttaacccccgaagatttaataggggagcttttacacatagaaaaacagttg
gatagggtaagagaaagaagatggggacctagaactatagatttagatattattttttat
gatgatttaataataaatgaaaaagatttagttattcctcataaggatatggaaaacaga
gagtttgtattaaaacctttgtgtgatatagatgaaaattttatacatccggttttaaaa
aaatcagtaagagaattgtatgataggttgaagtaa

DBGET integrated database retrieval system