KEGG   Clostridium botulinum B1 Okra: CLD_3744Help
Entry
CLD_3744          CDS       T00671                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
939202..940389
Genome map
AA seq 395 aa AA seqDB search
MIIELNKNSFPEEFNKIEVHEGSVNIFMNKNSITPLKIFNVLAPAANIIKQEMLALGGDC
AVNKYCINCKVETSDIILLGTKRQYKKLLQKLKCMTFFRIEEIVGELENYINNHKKIKTV
LRDGREINYENLKVMGIINCTPDSFYEGSRKNSIEEALNSAEKMLKEGAEILDIGGESTR
PGSDPVDEEEEIKRVVPVIREIKNKFKDVIISIDTYRANTAKAAIEAGADIVNDISAMKY
DENMVKVVKEYNVPVILMHVKGKPKDMQIDPVYENLMKEIHLYFNERIEYCKSHGITEDK
IILDPGIGFGKTVEHNLKIMNRIEELKSFNLPVLLAASRKATIGKVLGDLPTEERLEGTI
ALSCLAVDSGLQMVRVHDVKENTRAIRMLEAVRKI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgattatagaattaaataaaaatagtttcccagaagagttcaataagatagaagtacat
gagggtagtgtgaatatatttatgaataaaaatagtattacccctttaaaaatttttaat
gtgctagctcctgcggccaatataataaagcaagaaatgctggctttaggtggagattgt
gctgtaaataaatattgtataaattgcaaagtggaaacttcagatataattttattagga
accaaaagacaatacaaaaaattattgcaaaagcttaaatgcatgactttttttagaata
gaagaaatagtaggggaattagaaaattatattaacaatcataaaaaaattaaaacggtt
ttaagagatggaagagaaataaactatgagaatttaaaggttatgggaattataaattgt
actccagattctttttatgagggttctagaaaaaattctatagaagaagctttaaattct
gcagaaaagatgttaaaagaaggtgcagaaattttagatataggtggagaatccacaaga
ccaggctctgacccagtagatgaagaggaagaaataaaaagagtagttcctgttataaga
gagataaagaataaatttaaggatgtcataatttccatagatacttatagagcaaatacg
gcaaaggctgccatagaggcaggggcagatattgtaaatgatataagtgctatgaagtat
gatgaaaatatggtgaaagtagttaaagaatacaatgtacctgtaatacttatgcatgta
aaaggaaaaccaaaggatatgcaaatagatccagtttatgagaatttaatgaaagaaatt
catctttattttaatgagagaatagagtactgcaaatctcatggcataacagaggataaa
ataatattagatccaggcataggttttggaaaaactgtagagcataatctaaaaataatg
aacagaatagaagaattgaaaagctttaatcttccagtacttttagcagcctcaagaaaa
gctaccataggaaaagttttaggagacttacctacagaagaaagattagaaggaaccata
gctttatcctgtttagctgtagattcaggacttcaaatggtgagagtacatgatgtaaaa
gaaaatacaagagccataagaatgttagaggcagtaagaaaaatataa

DBGET integrated database retrieval system