KEGG   Clostridium botulinum B1 Okra: CLD_A0034Help
Entry
CLD_A0034         CDS       T00671                                 

Definition
putative guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLD_A0034
Enzymes [BR:cbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CLD_A0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pCLD:complement(21478..22071)
Genome map
AA seq 197 aa AA seqDB search
MQDNNTDIIICLVGESGSGKSTIAELLEKEGYNYIESYTTRKPRYKGERGHIFLNSINDR
NDIDILDDGYYPKENVIAYACYKDEHYYATKEQYKNKGTSIYIVEVKGVNELRSEIDDAK
ILVLYLRADEQIRRGRMIKRYIDVNGNTSKNYLIAERKAQERIIHDKENFQIIPCDYVID
TNMPITEVLKSIKTIIE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataacaatacagatataattatttgtttagtaggggaatctgggtccggtaaa
tctactatagcagagttattggagaaggaaggatataattatatagaaagctatacaact
aggaaaccacgatataaaggtgagagaggacacatatttttaaatagtataaatgatagg
aatgatattgatatattagatgatggttattatcctaaagaaaatgtaatagcgtatgct
tgctataaagatgagcactactatgctactaaagagcaatataaaaataagggaacatct
atatatatagtagaagttaagggagttaatgaattaagatcagaaatagatgatgcaaaa
atattagtattatatttaagagcagatgagcaaattagaagaggtagaatgataaaaaga
tatattgatgtaaatggaaatacgtctaagaactatttaatagcagaacgaaaggcacaa
gaaagaataatacacgataaagaaaattttcaaataataccgtgtgattatgtaatagat
actaatatgccaataactgaagtattaaaaagtataaaaacaataatagaataa

DBGET integrated database retrieval system