KEGG   Coxiella burnetii CbuK_Q154: CbuK_0483Help
Entry
CbuK_0483         CDS       T00788                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438114..438674
Genome map
AA seq 186 aa AA seqDB search
MTIAYVGVGANLDNPLKQVQIAVSNLSTLPQTACLGYSSFYRSKPLGPTDQPDYINAVAA
VETTLSPQMLLKALQRLEEKQGRCRGGKRWGPRIIDLDILLYGDLALQSDELCLPHPGLF
VREFVLYPLAEVAEDLILPGGESILELKAKCPDRGIERIIKNPSSLLPFPFRGKGLEKEG
DTKALA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagcctatgttggcgtaggggcaaacctggataatccgctcaagcaagtgcaa
atcgcggtaagtaatttgtccacgttgccgcaaactgcttgtcttggctattccagcttt
tatcggagcaaaccgttgggcccgactgatcaaccggattacatcaacgccgtagcagcg
gttgaaactaccttgtccccccaaatgcttttgaaagcattgcaacgactcgaagaaaaa
caaggccggtgtcggggcgggaaacgatgggggccgcggattatcgatctcgatatttta
ttgtatggagatcttgcgcttcagagcgatgagctttgtcttccccatccgggacttttt
gtgcgggaatttgtgctttatccactggctgaagtcgcagaagacttgattttacccggc
ggcgagtctattttggaactgaaagcaaaatgccctgatcgaggcattgaacgaattata
aaaaacccctcttcactacttccttttccctttagggggaaagggttggagaaagagggt
gatacaaaggcgctagcatga

DBGET integrated database retrieval system