KEGG   Coxiella burnetii CbuK_Q154: CbuK_0491Help
Entry
CbuK_0491         CDS       T00788                                 

Gene name
algC
Definition
phosphoglucomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuK_0491 (algC)
   00030 Pentose phosphate pathway
    CbuK_0491 (algC)
   00051 Fructose and mannose metabolism
    CbuK_0491 (algC)
   00052 Galactose metabolism
    CbuK_0491 (algC)
   00500 Starch and sucrose metabolism
    CbuK_0491 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    CbuK_0491 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    CbuK_0491 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CbuK_0491 (algC)
Enzymes [BR:cbc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CbuK_0491 (algC)
    5.4.2.8  phosphomannomutase
     CbuK_0491 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
441393..442808
Genome map
AA seq 471 aa AA seqDB search
MAAQGKINQWNVPEIVPATLFRAYDIRGPVTSEALTPGLAYAVGLSIGSEAREQGQKAIV
VGRDGRLSGPKLTAALIQGLCETGLAVLNVGLVPTPLVYFATNRLETNSGVMVTASHNPG
HHNGFKIVLNGKTLRSEEIATIRTRILERRFVKGHGAVVDVDIIEDYESYITKHIQLDRP
LKVVVDCGNGIAGKVAPALYRKLGCEVVELFCEVDGHFPNHHPDPTIPANLTDLIHKVKE
TQADLGLAFDGDADRLGIVTDKGEIIWPDRQMMLFSMDVLSRLPGSDIVFDVKCSRSLAE
IIKKYGGNPVMWRTGHSILKAKLFEIGAPLAGEMSGHIFFKDEWFGFDDGIYVGARLLRI
ISQTNQRTSEIFAELPDSVNTPELKLPMTEEKKQPFMQALLKKADFGNAKLITIDGLRVE
FEDGWGLIRPSNTSPYLILRFEADTEEKLKRIQEIFRTQLRMIDNALELPF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
ttggcagctcagggcaaaattaatcaatggaatgtccccgagatagtgccggcgacgctt
tttagagcttacgatattcgcggcccggtcacttctgaggcattgacacccggattagct
tatgccgttggcctttcgatcggcagcgaagcgcgcgaacaggggcaaaaagcgattgtc
gtgggtcgcgatgggcgtttatcagggcctaaattaacagctgctttgattcagggattg
tgtgagaccggcctggcggtgcttaatgttggtttggtgccaacgccgctggtttacttt
gccacgaatcgtttagaaaccaattccggcgtgatggtcacagcgagtcataatccgggg
caccacaatggttttaaaattgttctgaatggaaaaacattgaggtcggaagagattgca
accatccgaacgcgtattctcgaaagacgctttgttaaaggccatggcgcggtggttgat
gtggacatcattgaggattatgaatcttatatcaccaagcatattcaattagaccgcccg
ttgaaagtggtcgtggactgtggcaatgggattgccggcaaagtggcgccggcgttatat
cgcaagctagggtgtgaagtagtggagttattttgtgaggtggacggccattttcctaat
catcatcctgaccctactattcccgccaatttaacggatttaatccataaagtaaaagaa
acgcaagccgaccttgggttggcttttgatggcgatgcagatcgtttaggtattgtgacg
gataaaggagaaattatctggcccgatcgtcaaatgatgttattttcaatggacgtatta
tctcgtttaccgggttctgatattgtttttgacgtcaaatgttcgcgttccttagccgaa
ataataaaaaaatacggcggcaatcccgtcatgtggcgaaccgggcattcaattttaaaa
gctaagctttttgaaatcggcgcaccgttggccggagaaatgagcggacatatctttttt
aaagatgaatggtttggttttgatgatggcatttacgtgggagcgcgattattacgaatt
atctcgcagactaatcaacggacgagtgaaatttttgcggagttgcccgatagcgtcaac
acgcccgaattaaaattgccgatgaccgaagaaaaaaaacaaccctttatgcaagcgtta
ttgaaaaaagctgattttggaaacgcgaaacttattacaattgatggattgcgcgttgaa
tttgaagatggttgggggttaattcgaccttccaacacctcgccttatttaattttacgt
ttcgaggctgatacagaagaaaaactaaagcgtattcaggaaatctttcgaacgcagttg
cggatgattgataatgcgttggagttgcccttttaa

DBGET integrated database retrieval system