KEGG   Coxiella burnetii CbuK_Q154: CbuK_0524Help
Entry
CbuK_0524         CDS       T00788                                 

Gene name
purD
Definition
phosphoribosylamine--glycine ligase (EC:6.3.4.13)
Orthology
K01945  
phosphoribosylamine--glycine ligase [EC:6.3.4.13]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cbc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(472999..474312)
Genome map
AA seq 437 aa AA seqDB search
MLGVAEKCYDLTIMNILIIGNGGREHALAWKVAQSPRVEKIWVAPGNAGTARELKTQNVP
IGVTDIKSLIAFAKKNQINLTLVGPEIPLAAGIVDHFQQENLIVFGPTQAAAQLETSKSF
CKTFMRRHGIPTARFEAFRNTSDAFSYLEQQSFPIVIKASGLAAGKGVVIAQSLQEAKET
VIAMMEEKQFGNAGSEIVIEEFLAGEELSFIAMVDGEHILPLAGSQDHKRRDDGDRGPNT
GGMGAYSPVPQLSDALQEKIMTTIMQPTVTALKSEGILYRGFLYAGIMITLNNEPKVLEF
NVRLGDPETQPLMMRLRSDLIELILSALSGRLNQTQSAWDSRAALTVVLAAGGYPAHYQK
GDIIQGLDQLSLPDVKVFHAGTQEINHQVVTDGGRVLGVTALGKDLREAQQKAYQAAQLI
TWPNCYYRHDIGHRAIS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttgttaggtgtcgctgaaaaatgttatgatctcaccattatgaatatacttataattggt
aatggcggtcgtgaacacgccttagcatggaaggtagctcaatcgcctcgagtagaaaaa
atttgggtggctcccggaaatgccgggacggctcgagagcttaaaacacaaaatgttccc
atcggcgtcactgacattaagagcttaatcgcctttgccaaaaaaaatcaaattaattta
acgctcgtggggcctgagattccactagcggctggtattgttgatcattttcaacaggaa
aatttaattgtttttgggcccacccaagctgctgcccaattagaaacttctaaaagtttt
tgcaaaacatttatgcgccgtcacggtattccaaccgctcgctttgaagcatttagaaat
acgagcgatgctttctcctatcttgaacaacaatcttttccaattgtaataaaagcaagc
ggtcttgcggcaggaaaaggtgttgttattgcacaatcattgcaagaagctaaagaaacc
gttattgcgatgatggaagaaaaacaatttggaaatgccggttcggaaattgtaatcgaa
gaatttttagccggcgaagaattaagttttatcgcaatggtggatggcgaacatatttta
ccactcgcgggttcccaagatcataaacgacgagatgatggggatcgcggtccaaacacg
ggtggcatgggtgcttattcacccgttcctcagctttccgatgctctacaagaaaaaatc
atgacgactattatgcagcccaccgtaaccgctttaaaatcagagggtattctttacaga
gggtttttatatgcgggaatcatgatcacattaaataacgagcccaaggtattagaattt
aatgtgcgcttaggcgatcctgaaacccaaccgctcatgatgcgtttgcgttccgatcta
atcgaattaattttatcggcgctttctggccgattaaatcaaacacaaagcgcatgggac
agtcgcgctgcactaacggtggtgcttgctgcgggaggatatcccgcgcactatcaaaaa
ggcgatattattcaagggctcgatcaattgtctctcccagacgtaaaagtctttcatgct
ggcacacaagaaattaatcatcaggttgttaccgatggcggccgcgtgcttggcgtcacc
gcattaggcaaggatttacgtgaagcacaacaaaaagcctatcaagcggcccaattaatt
acttggccgaactgttattaccgtcacgatatcggacatcgggcaatttcttaa

DBGET integrated database retrieval system