KEGG   Coxiella burnetii CbuK_Q154: CbuK_0538Help
Entry
CbuK_0538         CDS       T00788                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbuK_0538 (pfkA)
   01230 Biosynthesis of amino acids
    CbuK_0538 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuK_0538 (pfkA)
   00030 Pentose phosphate pathway
    CbuK_0538 (pfkA)
   00051 Fructose and mannose metabolism
    CbuK_0538 (pfkA)
   00052 Galactose metabolism
    CbuK_0538 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CbuK_0538 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CbuK_0538 (pfkA)
Enzymes [BR:cbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CbuK_0538 (pfkA)
Protein phosphatases and associated proteins [BR:cbc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CbuK_0538 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(490239..491237)
Genome map
AA seq 332 aa AA seqDB search
MQLGANVTEIKKLIVLTSGGDAPGMNAAIRAVVRTALHYQFEVYGVTAGFAGLVNGQVVP
LNSRAVANCIQRGGTILKTGRFENFRFKAVRDKAREFLKKLQIDAMIVLGGNGSFAGASK
LYQEGGPQMIGIPCTIDNDIQGTDYCIGFDTACNTALQAIDKIRDTAFSHERNFLIEVMG
RSSGFIAVNVGIAGGAEIIALPEFHVDIDTLTQKIKKQHGKKSASIIVAAEANQPGHSFE
VAKQIKEKTGIEYRVCVLGHTQRGGTPTVKDRVLASLMGAQAIEALKKGLTEKMIAYQNG
KIAVAPLPDPDNGTRYFADEALLRVNNIICAM
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaggagccaacgtgaccgaaataaaaaaattaatagtgcttacttctggaggc
gatgcacctggcatgaatgctgcaatccgtgctgttgtgcgaacagcgctccattatcaa
tttgaagtttacggtgtcacagccggttttgctggtttagttaacgggcaggtcgttcct
ctcaattcgcgcgcggttgccaattgcatccagcgtggcggtacaattttaaaaacgggg
cgtttcgaaaattttcgtttcaaagcagtccgtgacaaagcgcgggaatttttaaaaaaa
ttgcaaatcgatgccatgatcgttctcggcggcaacggcagttttgcgggcgcttcaaaa
ctgtaccaagaaggcggacctcaaatgattgggattccatgcactatcgataacgacatt
caaggaacggattattgcattggttttgatacggcttgtaatacagctttgcaagctatc
gataaaattcgcgatacggcattcagccacgagcgaaattttttaattgaggttatgggg
cggtcttccggttttatcgcggtgaatgtcggcatcgctggcggtgcggaaatcattgcg
ctacctgaatttcacgtcgatattgatacattgacgcaaaaaattaaaaaacaacacggt
aaaaaatcagcctccattattgtcgctgctgaagccaatcaacccggccacagctttgaa
gtcgccaaacaaataaaagaaaaaaccggcatcgaataccgcgtctgcgtcctcggccac
acccaacgcggcggaaccccaacggtaaaagatcgcgtgcttgcttctctgatgggagca
caggccattgaagcactaaaaaaaggattaaccgaaaagatgatcgcttatcaaaatggt
aaaatagctgttgcgcccctgccggatcccgacaacggaacgcgatattttgctgatgag
gccttgttaagggttaataatattatttgcgccatgtga

DBGET integrated database retrieval system