KEGG   Coxiella burnetii CbuK_Q154: CbuK_0582Help
Entry
CbuK_0582         CDS       T00788                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbuK_0582 (tpiA)
   01230 Biosynthesis of amino acids
    CbuK_0582 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuK_0582 (tpiA)
   00051 Fructose and mannose metabolism
    CbuK_0582 (tpiA)
   00562 Inositol phosphate metabolism
    CbuK_0582 (tpiA)
Enzymes [BR:cbc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CbuK_0582 (tpiA)
Exosome [BR:cbc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CbuK_0582 (tpiA)
  Exosomal proteins of bladder cancer cells
   CbuK_0582 (tpiA)
  Exosomal proteins of melanoma cells
   CbuK_0582 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
530991..531806
Genome map
AA seq 271 aa AA seqDB search
MIPLEWRQISAWRGCHMQRRPLVAGNWKMHGSRESVGQLLRALKHGCERLETAELAVFPP
FVFLQQCEEALMRTQISWGAQDVSEFERGAYTGEVSAAMLRDFHCRYVIVGHSERRQRHG
ETNEQVAAKVRAALRCGIRPIICVGETEKQRNANQTLSVIKEQLAVVLQMNDNLASLEGM
VVAYEPIWAIGTGKNATPSQAEEVHAALRDQLHRQDATLAESTRLLYGGSVKPDNAAALF
EMPNIDGALVGGASLEAEQFLKIGQQCNQSF
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgattccgctagaatggcgccagatttcagcatggagaggatgtcatatgcagcgtcga
ccgttagtggctggtaattggaaaatgcatggttcgcgcgaaagtgtgggtcaattatta
agggcattaaaacacggttgcgagcgtctggaaacggcggagctcgctgttttcccccct
tttgtctttttgcagcaatgcgaagaggcgctgatgcgaacgcaaatctcttggggtgcg
caggacgtttccgaattcgaaagaggcgcttatacgggggaagtctctgctgccatgctg
cgcgatttccattgccggtatgtaatcgtcggccactcggaaaggcgtcagcgtcacgga
gaaaccaatgagcaagtggctgcgaaggttagggcagccctccgttgcggcattcgtccc
attatttgtgtaggggaaactgaaaagcagcgcaatgctaatcagacattatcagtgata
aaagagcaacttgcagttgtattgcagatgaacgataatttggcgtcgttggaaggcatg
gtggtggcttatgagccgatatgggcgattggaaccggaaaaaatgcaacgccttcgcaa
gcagaagaagtgcacgcagcccttcgagatcaattacaccgtcaggatgcgacactagcc
gaaagcacgcggcttttatatgggggcagtgttaagccggataatgcagccgctttgttt
gaaatgccaaatatagatggcgctttagtgggtggggcttctttggaagctgaacaattt
ctaaaaatagggcaacaatgcaatcaatcattttaa

DBGET integrated database retrieval system