KEGG   Coxiella burnetii CbuK_Q154: CbuK_0699Help
Entry
CbuK_0699         CDS       T00788                                 

Gene name
asnB1.1
Definition
asparagine synthetase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cbc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649550..651448
Genome map
AA seq 632 aa AA seqDB search
MCGIAGIFNLNGKPVAFDQIKAMTDSIAHRGPDGEGQFTDKYIGLGHRRLAIIDLSPAGH
QPMQTKDGRYLITYNGEVYNFKILRKELETLGYSFFSNTDTEVVLNAYVQWGEKCLEKFN
GMFAFAVWDRKEKTLFLARDRYGIKPLYYYQTNDCFVFASEIKAIIASGLYGAEINKEAL
VEYLTFQNFFTDRTLFKDVRIMPAGHFMMVKRENSSLHQYWDFNFTNDSALSEKMLLEKI
NDLFQQAVNRQLVSDVPVNSYLSGGVDSGSITMIAAKQLPHIRTFTVGFDLSSASGLELA
FDERQAAEHLSYLAGTEHYEMVLKAGDMERCMQDLVWHLEEPRIGQSYPNFYAAKLASKF
GKVVLAGTGGDELYAGYPWRYLCGQSSENFEDYIDKYYQYWQRLMSNKNLFKVLAPIAEE
VKSIWTRDIFANVFRIKDTPIKTEDYINYSLYFEAKTFLHGLLVVEDKLSMAHGLETRVP
CLDNDFVDFALQVPVKYKLSDFAFERVNENDTFSKREKRMNGKKILRKMMSRYVTDNVAH
APKQGFSAPDASWFKGESIEFVRSLLGDRNAKIFELLDYSVVNHLVNDHIQNHHNHRLLI
WSLIYLEIFMQVHLSKGHKSNYHLFTRETVEL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggtattgcaggcattttcaatttaaatggtaagccagttgctttcgatcaaatt
aaagcgatgacggattctattgctcatcgcggaccggatggcgagggacagtttactgac
aaatatatcggattgggacatagaagactggcgattatagatttaagtcccgcagggcat
caaccgatgcaaacgaaggatggtcgttatcttattacttataatggtgaagtttataat
ttcaaaatactgcgtaaagagttagaaactttgggctattcatttttttctaataccgat
acggaagtggttttaaacgcttatgtacaatggggagaaaagtgtttagaaaaatttaat
ggcatgtttgcttttgccgtttgggatcgcaaagaaaaaacattatttttagccagagac
cgttatggaattaaaccattatattattatcaaacaaacgattgcttcgtttttgcctct
gaaataaaggcgattattgcttcaggtctttatggcgctgagattaataaagaggctttg
gtagaatatttaactttccaaaatttctttacggatcgaacgctttttaaagatgtccgc
attatgcctgccggtcattttatgatggtaaaaagagaaaattcatctcttcatcaatat
tgggattttaattttacaaatgattcagcgctttctgaaaaaatgctattagaaaaaatt
aatgatttgtttcagcaagcggttaaccgccagcttgtcagtgatgttcctgtgaatagt
tatttaagcgggggggtggactcgggatcgattacaatgattgcagcaaaacaattgccg
cacatacgtactttcacagtagggttcgatttgagttccgcttctggtttggaattagca
tttgacgagcgtcaagcagccgaacatctttcttatcttgctggcactgagcattatgaa
atggtattaaaagcgggagatatggagcgttgcatgcaggatttggtgtggcatttggaa
gaaccgcggatcggacaaagttatccaaatttttacgcggctaaattggccagtaaattc
ggtaaagttgtattagctggaactggcggagacgagctttacgcaggatacccatggcgc
tatttgtgcggacagagtagcgaaaattttgaagattatattgataaatattatcaatat
tggcagcggttgatgagtaacaaaaatctttttaaagttcttgctcctattgctgaagaa
gtaaaatctatttggactcgagatatatttgctaatgtttttcgaattaaggatacgcca
ataaagactgaagactatattaattattctttatattttgaagccaaaacatttttgcat
ggattgctcgtagttgaagacaaactaagtatggcgcacggacttgaaactcgggtacct
tgtcttgacaatgatttcgttgattttgctttacaggtgcctgtgaaatataagctatct
gatttcgcgtttgaaagggtcaatgaaaacgacacattctctaaacgagaaaaaaggatg
aatggtaaaaaaatcttacgtaaaatgatgagtcgctatgtgaccgataacgtcgctcat
gctccgaagcaaggattctcggcaccggatgccagttggttcaaaggagaaagtatcgaa
tttgtgcgctcgttgcttggtgatagaaatgctaaaattttcgaattactcgattattca
gtcgtgaaccatttggtgaatgaccacattcaaaaccatcacaatcaccgattattaatt
tggtcactaatttatttagaaatttttatgcaggttcatttgtctaagggtcataaatct
aattatcatttgtttacgcgagaaacggtggagctttaa

DBGET integrated database retrieval system