KEGG   Coxiella burnetii CbuK_Q154: CbuK_0708Help
Entry
CbuK_0708         CDS       T00788                                 

Gene name
asnB1.2
Definition
asparagine synthetase family protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CbuK_0708 (asnB1.2)
Enzymes [BR:cbc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CbuK_0708 (asnB1.2)
Peptidases [BR:cbc01002]
 Cysteine Peptidases
  Family C44
   CbuK_0708 (asnB1.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660487..662400
Genome map
AA seq 637 aa AA seqDB search
MCGIVGFWDFRRSWKKVQYQKVAAKMADQITSRGPDSSGVWCDEKTGLAFGHRRLAVIDL
STAGHQPMLSHSGNTAIIYNGEIYNAPFIRRELENAGIYCCGHSDTEVLLEACELWGVKS
AVKKMNGMFAFAYWNKLEKKLYLGRDRLGIKPLFWSLKNNIFYFSSQLKALAAHPVWNVE
IDRTALTSYFRFNYIPAPLSIYKGVYKLKPGTILTIDPNQKIIEETFWSLETVCQKNINK
KKIDDNEVLEKTETLLQDAVKCRMYSDVPLGAFLSGGIDSSAVVALMQAQSTNRIKTFSI
GFYEKEYNEASYAKEVAQHLKTDHHELYLHVDEAARLIPQIPEWYDEPFADSSQIPTYLV
SQLARQHVTVSLSGDGGDELFAGYNRYLLAENLWSKLVRFPLWMRQSGSKTINFFSPSAW
DKFANVIPRKLRPSSVGDKAHKLAALLTQSSEDLYKGLVSLWERPAELVIDGSDISLWPE
PLPDLNFTERMQYIDTLTYLPDDILTKVDRASMAVSLEARIPLLDYRLVEYIWSLPMRFK
LQRGETKWLLRRVLGKYVPEKLFTRPKMGFGVPIDHWLRGQLREWAEDLLSVPKLEKDGL
LHSSLIRQRWQEHLSGKRNWQYSLWSVLMFQLWRERW
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtcggattttgggattttcgtcggtcttggaaaaaagtgcaataccaa
aaagttgctgctaagatggcggatcaaattacttctcgaggcccagactcatcaggcgtt
tggtgcgacgaaaaaacgggactggcttttgggcaccgacggttagccgttattgatctt
tcgacagcagggcatcaacccatgttatcgcattcaggaaataccgccatcatttacaat
ggtgagatttataacgctccctttattcgtcgagaattagaaaatgcaggtatctattgt
tgcgggcattcagacactgaggtgcttctcgaagcctgtgaattatggggtgttaaatct
gcagtaaaaaaaatgaatggaatgttcgcctttgcttattggaacaaacttgaaaaaaag
ctgtatcttggtcgcgatcgtttaggaattaaaccgttattttggagcttaaaaaataac
attttttatttctcttcgcaattaaaagcactcgccgcgcatccggtttggaatgttgaa
attgaccggacggctttaacctcctactttcgatttaattatatccctgcgccattatca
atttacaagggtgtttataaactaaaaccaggcacgatactcaccatcgaccccaatcaa
aaaattattgaagaaaccttctggtcgttagaaacagtttgtcaaaagaatattaataag
aaaaaaattgacgacaacgaagtactagaaaagacggaaactctattgcaggacgctgtt
aaatgtcgtatgtactcggatgttccgctgggtgcctttttatccggtggtattgatagt
tctgccgttgttgctttaatgcaggctcaaagtacaaatcggattaaaactttttctatc
ggattctatgaaaaagaatataatgaggcttcttatgcgaaagaagttgcccaacatttg
aaaaccgatcatcacgaattatatttgcatgtggatgaagctgctcgattgattcctcaa
attccggagtggtatgacgagccatttgcagattcatcccaaatacccacttatcttgtt
tctcaattagcaaggcagcacgtaacggtaagtttatcgggcgacgggggtgatgaatta
tttgccggttataatcgctatcttttagccgaaaatttatggtccaaattagttcgattt
ccgctgtggatgagacagtcgggtagcaaaacgattaattttttcagtccttcagcgtgg
gataaatttgcaaatgtgataccacggaagttacgtccatcttctgtaggggataaggcg
cataagttagcggcgctattaacccaatcatcggaggatttatataaaggacttgttagc
ctttgggaaagaccggctgaattagtgattgatggttccgatatttccttatggccagag
ccgttgccggatttaaattttacggaacgaatgcagtacatcgataccctcacctattta
cctgatgatattttaacaaaagtagaccgtgctagcatggctgttagcttagaagcaagg
attcctttgttagactatcgattggtggaatacatttggtctttacccatgcgatttaaa
ttacaacgaggtgaaactaaatggttattgcgacgtgtattagggaaatacgtcccagag
aaattgttcactcgtcccaaaatgggctttggtgtgccgatcgatcattggttgcgtggt
caattgagagaatgggcagaggatttattatctgttcctaaactagaaaaagacggctta
ctgcattcctcattaattcgtcaacgctggcaggaacacctttctgggaaaagaaattgg
caatattcactttggagcgtgcttatgttccaattgtggcgtgagcgctggtga

DBGET integrated database retrieval system