KEGG   Coxiella burnetii CbuK_Q154: CbuK_0717Help
Entry
CbuK_0717         CDS       T00788                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00040  Pentose and glucuronate interconversions
cbc00052  Galactose metabolism
cbc00500  Starch and sucrose metabolism
cbc00520  Amino sugar and nucleotide sugar metabolism
cbc01100  Metabolic pathways
cbc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CbuK_0717 (galU)
   00052 Galactose metabolism
    CbuK_0717 (galU)
   00500 Starch and sucrose metabolism
    CbuK_0717 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CbuK_0717 (galU)
Enzymes [BR:cbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CbuK_0717 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACJ19973
Position
672172..673059
Genome map
AA seq 295 aa AA seqDB search
MKKVTTAVFPVAGLGTRFLPVTKAGPKEMLPIVDKPIIQYVVEEAIAAGITHLVFVTSSS
KRAIEDYFDSNYELETRLRSSRKLDALKLIQNLLPKEVRISYVRQAHPLGLGDAVLSAKH
VVGDQPFAVLLPDDIIDCGEKSCLQLMMEAFEKHQRNIIAVEQVPLNQTDKYGIVSVVDE
HQVKRITGMVEKPPLGSALSDWAVTGRYILSPRVFDHLDAISCGVGGEIQLTDAIVALLQ
EEQVLAFPFKGHRYDCGSRLGFLQATIAYALKRPEFKEPLREYLFKLLGSECVGG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtcactactgccgtttttcctgtggccggattgggaacacgattcctgccg
gtaaccaaagcggggcccaaagaaatgttgccgattgttgataagccaattattcaatat
gtagtagaagaggcgatcgctgccggcattacgcatctcgtttttgtaacgagtagcagc
aagcgggctatcgaagattattttgatagtaattatgaattggaaacgcggttgcgctcc
agtaggaaactggatgccttgaaattaatacagaatctcttacccaaagaagttcgtatt
agctatgtgcgtcaagcgcaccctttaggcttgggtgatgcggtattatcggcgaaacat
gtcgtcggcgaccagccgtttgcggtattgttacccgatgacattattgactgcggtgag
aaaagctgtttgcaattgatgatggaagcttttgaaaagcatcaacggaatatcattgcg
gttgaacaggtgcctttaaatcaaaccgataaatatggcatcgtttctgtggtggatgag
catcaggtgaagcgaattactggtatggttgaaaaacctcccctcggaagcgcgttgtca
gattgggctgtcaccggccgctatattttgtctccacgtgtttttgatcatttggatgcc
atcagttgtggcgtggggggggagattcaactaacggatgcgattgtcgcgctgttgcaa
gaagagcaggtgcttgcctttcccttcaagggtcaccgttacgattgcgggagtcgattg
ggtttcttgcaggcgacgattgcttatgcgctcaaacggcctgaatttaaagagcccttg
cgggaatatttatttaaactgttgggctcggagtgcgtggggggttaa

DBGET integrated database retrieval system