KEGG   Coxiella burnetii CbuK_Q154: CbuK_0917Help
Entry
CbuK_0917         CDS       T00788                                 

Definition
acyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CbuK_0917
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CbuK_0917
Enzymes [BR:cbc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CbuK_0917
Lipid biosynthesis proteins [BR:cbc01004]
 Desaturase
  First
   CbuK_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(862199..863191)
Genome map
AA seq 330 aa AA seqDB search
MAGAMLIACGLSITAGYHRLAAHKSYKAAWPIRLFFALFGAAAFEGSIVEWATDHRKHHR
YTDTDQDPYSIKKGFWYAHIGWLFTLDPSKRDFSNVQDLLDDPIYRFQHRFFPIIAILMG
FGLPMAIGALWGDPLSALVIAGALRITVVYQMTFFINSLCHMIGKQTYKNSSARDNWVTA
LLTMGEGFHNFHHQFPIDYRNGVRFFHFDPTKWLIYLLSRMGLVSGLKRVEQRRIIKYRL
ETDTQRLALLSAERVEVVKPLYERIHHLLGRLEELEKSYLALKEAQFKAYKNRLREIRQK
LKATERELRTFLTLWSKVARPLQTCQLSGS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttggcgggggcgatgcttattgcttgcggtctttcgataacagcgggttaccaccgcctt
gccgctcataaaagctacaaggcggcatggcctattcggttattttttgcgctttttgga
gcggcggcttttgaaggaagtattgtagaatgggccactgaccatcgaaagcatcaccgt
tataccgacacagaccaagatccctacagcatcaaaaaaggcttttggtatgcccacata
ggatggctatttacgcttgatccttcaaaacgggattttagcaatgtccaagatttgctg
gatgatcctatctatcgctttcaacatcgtttctttccgattattgctattctaatgggt
tttggattgccaatggccattggcgcgctttggggcgacccgctcagcgctcttgtgatt
gctggcgctttaaggattacggtggtttatcagatgacgttttttattaattcactttgt
catatgattggcaaacaaacttacaaaaattcatctgctcgggataattgggtaaccgcc
ctgcttactatgggcgaaggttttcataattttcaccatcaatttccgattgattatcga
aacggcgtgcgcttttttcactttgatccaacgaaatggttgatttatttgttatcccgg
atgggattggtgtctggcttaaagcgtgtagagcaacgcagaatcattaaataccgtctg
gaaaccgatactcaacgtttggcactgctttcagcagaaagagtagaggtcgtaaaaccg
ctttatgagcgcattcatcacttgttagggcggctggaagaacttgaaaagagttattta
gcattgaaagaggcgcaatttaaggcttataaaaaccgactccgagaaatacgacaaaag
ctaaaagcaacggagcgcgagcttcgaactttcttaactctgtggagcaaggtggcccgg
ccgcttcagacttgtcaacttagtggatcataa

DBGET integrated database retrieval system