KEGG   Coxiella burnetii CbuK_Q154: CbuK_0943Help
Entry
CbuK_0943         CDS       T00788                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cbc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cbc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(889625..890566)
Genome map
AA seq 313 aa AA seqDB search
MGFAIIDLEGVALSPQERELLQHPQVAGVILFTRNYENPSQLRSLIQTIKKIRPLFVAVD
QEGGRVQRFHRGFTDLPSMRYFGECYQHDPLQARKHLENALKTVVHELKEVGIDVNMTPV
LDIDQGKNEIIGERSFSGDPRVVEALGSVVIDTLHANRMPAVAKHFPGHGGVTADSHQAL
PIDERDPEAILQCDWIPFSALSSRLDAIMPTHIIYPAFDEKPATFSRYWLQDMLRQRLNF
RGVIISDDLTMQGAAVIGDYPTRAAQALEAGCDLLTICNSREGVIAILDSLLHYRNPESQ
QRLLSFSRFTTGG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttgggctttgccattattgacctcgaaggcgtggcgctttcgccgcaagagcgtgaattg
cttcagcatccccaagtcgctggagttattttattcactcgcaactacgaaaatccctct
caactccgttcactcattcaaacgattaaaaaaattcgcccgctatttgtagctgtagac
caagagggggggcgtgttcagcgatttcatcgaggatttacggatctgccgagcatgcgt
tattttggagagtgttaccagcacgacccgctccaggcacgaaagcacttagaaaacgcg
ttgaaaacggtggttcatgaattaaaggaagtggggatcgatgtcaatatgacgccagtg
ctagacatcgaccagggcaaaaacgaaatcatcggtgaacgcagtttcagtggtgatcca
agggttgttgaagccttgggcagcgttgtaatcgataccctccacgcgaatcgaatgcca
gcggtggctaaacatttcccggggcatggtggggtaaccgccgattcccaccaagctttg
cccatcgatgaacgagacccagaagcgattcttcagtgcgattggattcctttttcagca
ttaagctcgcgcttggacgctattatgcccacccatattatttatccggcttttgatgaa
aagccagcaaccttttcacgttattggctgcaagacatgttgcggcaacgtctcaacttt
cgaggggttatcatcagtgatgatttaactatgcaaggggctgccgttataggcgactat
ccgactcgcgccgctcaggcgctggaagcgggctgcgatttgttaaccatttgcaatagc
cgtgaaggagtgatcgcgattctggatagtcttctccattaccgcaatccagaatctcag
caacggcttctaagtttttcacgcttcaccacgggcgggtaa

DBGET integrated database retrieval system