KEGG   Coxiella burnetii CbuK_Q154: CbuK_1025Help
Entry
CbuK_1025         CDS       T00788                                 

Definition
sterol delta-7-reductase (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    CbuK_1025
Enzymes [BR:cbc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     CbuK_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
976792..978159
Genome map
AA seq 455 aa AA seqDB search
MTPEVQYNASYRLLRYSLFPLFLITVCPPAAIIMWYTNVALNGSLTALAVLFTQKGFFTT
LYQIWSPVFFGTREAWFIISIFMITQLLLMRIVPGKRFEGPITPKGNVPVYKANGVLCFG
ITLTLFYLCAYQFRWFPPTIVYDHFGGILGALNIFSLIFCFILYFKGRFAPSTSDHSLSG
NFIFDYYWGTELYPRILGWDIKMFTNCRFGMMGWPIIILSFAAKQNQLYGLSNSMLVALL
IQLVYIGKFFWWERGYLRSLDIMHDRAGFYICWGCLVWVPSIYTSPLLYLVNHPIPLSWF
SADIILFLGVWCVFINYFADAQRQKVRASNGNCKIWGKKPALIRATYTTEQGKQKQTVLL
ASGWWGISRHFHYLPEIGAAFFWTVPALFSHFLPYFYVVYLTILLTHRSLRDENRCHKKY
GPDWEIYCQQVPSRIIPYFLTKRFNAMVKWRKSAN
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggaagtgcagtacaacgcgtcttatcgattattgcgttattctttgtttcca
cttttcttaattaccgtctgcccgcctgccgctattattatgtggtacacgaacgtcgct
ttgaatggttccttaacagcgctagctgttcttttcacgcagaaaggattttttaccact
ctttatcagatctggagtcctgtcttttttggcacgcgagaagcttggttcattattagt
atctttatgatcactcaattgttactcatgcgaatagtccctgggaaacgtttcgagggt
cctatcacaccaaaagggaacgttcctgtctacaaagcgaatggggttttatgctttggt
attacgttgacgttattttacctttgtgcttatcaatttcgatggtttccgccgactatt
gtttacgatcattttggcggtattttaggtgcgttaaatatttttagtttaattttttgt
ttcattctttatttcaaagggcgttttgcaccctccacttccgatcatagtctaagcggt
aattttatttttgactattattggggaaccgaactatatccccgcattcttggatgggat
atcaaaatgttcaccaactgccgtttcggaatgatggggtggccgattattatcttgtca
tttgctgcaaaacaaaatcaattgtatggattaagcaattcgatgttagttgcgctattg
attcagttagtttatatcgggaaatttttttggtgggagagaggttatttgcgttcattg
gatatcatgcacgatcgagccggtttttatatctgttggggatgtttagtgtgggtcccg
agcatttatacttctcctctcttatatttagttaatcatcccattcccttaagctggttc
agtgcagatataattttatttttgggggtctggtgtgttttcattaattattttgccgat
gcgcagcgccaaaaagttagagcctctaacggtaattgtaaaatttggggcaaaaagcct
gccctcattcgggccacttacacaacggagcaaggtaagcaaaagcaaacggtgttactg
gcttcgggctggtggggaatttctcggcattttcattacctcccggaaataggcgctgct
tttttctggacagtacctgcattattttcacattttttgccctatttttatgtagtttat
ttaactattttacttacgcatcgttcgctacgcgatgagaatcgttgccataaaaaatac
ggccccgattgggaaatttactgccaacaggtaccctctcggataattccttatttttta
actaaaagattcaatgctatggtaaaatggcgaaaatctgcaaattaa

DBGET integrated database retrieval system