KEGG   Coxiella burnetii CbuK_Q154: CbuK_1135Help
Entry
CbuK_1135         CDS       T00788                                 

Definition
6-phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbuK_1135
   01230 Biosynthesis of amino acids
    CbuK_1135
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuK_1135
   00030 Pentose phosphate pathway
    CbuK_1135
   00051 Fructose and mannose metabolism
    CbuK_1135
   00052 Galactose metabolism
    CbuK_1135
  Energy metabolism
   00680 Methane metabolism
    CbuK_1135
Enzymes [BR:cbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CbuK_1135
Protein phosphatases and associated proteins [BR:cbc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CbuK_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089900..1091162
Genome map
AA seq 420 aa AA seqDB search
MSKKNVFYAQSGGATAVINATACGVIQTAAQYPTKIGKVLAGRNGIIGALKEELIDTSLE
SLENIAALRHTPSSAFGSCRYKLNNIHHDRRQYERLIEVFKAHDIGYVFYNGGGDSQDTT
HKISQLSQLMDYPLVCIGLPKTIDNDLPFTDNCPGFGSVAKYIAVSTQEAALDVRGMCAT
STKIFILEVMGRHAGWIAASSALGKSQPDDAPHLILFPEVPFQTEQFLTKVSRSVEKNGY
CVIVASEGIRHPDGRFVAESGLHDAFGHEQLGGVAPILARLIKKRLNFKYHWAVADYLQR
AARHIASQTDLDQAYALGKTAVEFALAGKSDVMLTIQREMGPDYKWRIGTAPLCEVANVE
HKMPTHYISEDGFGITEACYTYLKPLIEGESYPPYKNGVPDYVTLKNQLVAKKLKEAFAV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaaacgtcttctacgcccaatcgggcggtgccacggcggtgattaatgcg
acagcctgcggagtcatacaaacagccgctcaatatcccactaaaattggaaaagttctg
gcgggacgtaacgggattattggtgctcttaaagaggagctcattgataccagtctggag
tctcttgaaaatatcgctgctttgcggcacaccccttcgagcgcttttgggtcctgccgc
tataaactgaacaatatccatcacgatcgccgtcaatatgagcggcttatcgaagttttt
aaagcgcatgatatcggctacgtgttttacaacggcggtggcgattcccaagacaccacg
cataaaatttcgcagttaagccaactaatggattatcccctggtttgcattggtctaccc
aaaaccatcgataacgatctcccttttactgataattgtccgggctttggttctgttgct
aaatatattgctgtttccactcaagaagcggctttggatgtacgcggtatgtgtgcgacc
tcgaccaagatttttattctggaggtcatggggcgccatgcgggctggattgcggcgtcg
tctgcattgggaaaatcccaacctgacgacgcgccacacttgattctatttcccgaagtt
cccttccaaaccgaacaattcctaacaaaagtaagcagatccgttgaaaaaaatgggtat
tgtgtcattgtggcttctgaaggtatccgtcatcccgacggacgatttgtagcggaatcc
ggattgcacgacgcttttggccatgaacaattaggcggggtggcacctattttagcaagg
ctgatcaaaaaacgacttaattttaaataccattgggccgttgcggattatttacaacga
gcggcccgccacattgcctctcaaacggatcttgatcaagcgtacgctctaggaaaaacc
gccgtggaattcgcgcttgctggaaaatccgatgtgatgctcaccatccaacgcgaaatg
ggtcctgattataagtggcgcatcggcacggctcccttgtgcgaagtcgctaatgtggag
cacaaaatgccaacccattatatcagcgaagacggatttggcatcacagaagcttgctat
acgtatcttaaacctctgattgaaggggaaagctaccccccttataaaaatggggtaccc
gattacgtcaccctaaaaaaccagttggttgcgaagaaattgaaggaagcttttgctgtt
tag

DBGET integrated database retrieval system