KEGG   Coxiella burnetii CbuK_Q154: CbuK_1135Help
Entry
CbuK_1135         CDS       T00788                                 

Definition
(GenBank) pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuK_1135
   00030 Pentose phosphate pathway
    CbuK_1135
   00051 Fructose and mannose metabolism
    CbuK_1135
   00052 Galactose metabolism
    CbuK_1135
  Energy metabolism
   00680 Methane metabolism
    CbuK_1135
Enzymes [BR:cbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CbuK_1135
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CbuK_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1089900..1091162
Genome map
AA seq 420 aa AA seqDB search
MSKKNVFYAQSGGATAVINATACGVIQTAAQYPTKIGKVLAGRNGIIGALKEELIDTSLE
SLENIAALRHTPSSAFGSCRYKLNNIHHDRRQYERLIEVFKAHDIGYVFYNGGGDSQDTT
HKISQLSQLMDYPLVCIGLPKTIDNDLPFTDNCPGFGSVAKYIAVSTQEAALDVRGMCAT
STKIFILEVMGRHAGWIAASSALGKSQPDDAPHLILFPEVPFQTEQFLTKVSRSVEKNGY
CVIVASEGIRHPDGRFVAESGLHDAFGHEQLGGVAPILARLIKKRLNFKYHWAVADYLQR
AARHIASQTDLDQAYALGKTAVEFALAGKSDVMLTIQREMGPDYKWRIGTAPLCEVANVE
HKMPTHYISEDGFGITEACYTYLKPLIEGESYPPYKNGVPDYVTLKNQLVAKKLKEAFAV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaaacgtcttctacgcccaatcgggcggtgccacggcggtgattaatgcg
acagcctgcggagtcatacaaacagccgctcaatatcccactaaaattggaaaagttctg
gcgggacgtaacgggattattggtgctcttaaagaggagctcattgataccagtctggag
tctcttgaaaatatcgctgctttgcggcacaccccttcgagcgcttttgggtcctgccgc
tataaactgaacaatatccatcacgatcgccgtcaatatgagcggcttatcgaagttttt
aaagcgcatgatatcggctacgtgttttacaacggcggtggcgattcccaagacaccacg
cataaaatttcgcagttaagccaactaatggattatcccctggtttgcattggtctaccc
aaaaccatcgataacgatctcccttttactgataattgtccgggctttggttctgttgct
aaatatattgctgtttccactcaagaagcggctttggatgtacgcggtatgtgtgcgacc
tcgaccaagatttttattctggaggtcatggggcgccatgcgggctggattgcggcgtcg
tctgcattgggaaaatcccaacctgacgacgcgccacacttgattctatttcccgaagtt
cccttccaaaccgaacaattcctaacaaaagtaagcagatccgttgaaaaaaatgggtat
tgtgtcattgtggcttctgaaggtatccgtcatcccgacggacgatttgtagcggaatcc
ggattgcacgacgcttttggccatgaacaattaggcggggtggcacctattttagcaagg
ctgatcaaaaaacgacttaattttaaataccattgggccgttgcggattatttacaacga
gcggcccgccacattgcctctcaaacggatcttgatcaagcgtacgctctaggaaaaacc
gccgtggaattcgcgcttgctggaaaatccgatgtgatgctcaccatccaacgcgaaatg
ggtcctgattataagtggcgcatcggcacggctcccttgtgcgaagtcgctaatgtggag
cacaaaatgccaacccattatatcagcgaagacggatttggcatcacagaagcttgctat
acgtatcttaaacctctgattgaaggggaaagctaccccccttataaaaatggggtaccc
gattacgtcaccctaaaaaaccagttggttgcgaagaaattgaaggaagcttttgctgtt
tag

DBGET integrated database retrieval system