KEGG   Coxiella burnetii CbuK_Q154: CbuK_1213Help
Entry
CbuK_1213         CDS       T00788                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1169420..1170313)
Genome map
AA seq 297 aa AA seqDB search
MMSKEAFFLKQSFHLRLRDDKRIVFSEPAVMGIINVSPNSFYHPHLDLNSALRTAEKMVD
EGADILDIGGEATNPFVDIKTDSPSTQIELDRLLPVIDAIKKRFPQLISVDTSRPRVMRE
AVNTGADMINDQRALQLDDALTTVSALKTPVCLMHFPSETRKPGSTTHFYFLQSVKKELQ
ESIQRCKKAGISEDRIIIDPGFGQGNYGKNVSENFYLLNKLPEFVAMGLPVLSGWSRKSM
IGDVLNQPPENRLFGSIAADVLAVYHGASIIRTHDVKATREAIKIATYTRSVDTIEE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtaaggaggcatttttcttgaagcagtcattccacctacggttgcgcgacgat
aaacgcattgttttttctgaacccgcggtaatggggataatcaatgtctctcccaattca
ttctaccatccgcaccttgatctaaattcggcgttgcgtacagcagaaaaaatggtggat
gaaggcgccgatattttggatattgggggtgaggccaccaacccttttgttgatatcaaa
accgattcgccttccacgcaaatagaattagatcgactgttgcccgtcattgatgctata
aaaaaacgatttccccaattaatttcggtggacaccagtcgtcctcgtgtaatgcgtgag
gcggtaaatacgggcgctgacatgatcaatgatcagcgcgctctgcaattggacgatgct
ttaacaaccgtttcagcgttaaaaacgcctgtttgtttgatgcattttccgtccgagacg
agaaaaccaggatcaacaacgcatttctatttccttcaatccgttaagaaagagttgcaa
gaaagcatccaacgttgtaaaaaagcgggtatttccgaagaccgaattatcatcgatccg
ggttttgggcaagggaattacggtaaaaatgtgtcagagaatttttatttattgaacaaa
ttacctgaatttgtggcaatgggattacccgtcttatcggggtggtcgcgaaaatcaatg
attggagatgttttaaatcaaccgcccgaaaatcgcttatttggaagtatcgcggctgat
gtattagctgtttaccatggtgcgtcaataatccgcacccatgacgtcaaagcaacacga
gaagcgataaaaattgcgacctatacgcgaagtgttgatacaattgaggagtag

DBGET integrated database retrieval system