KEGG   Coxiella burnetii CbuK_Q154: CbuK_1281Help
Entry
CbuK_1281         CDS       T00788                                 

Gene name
holA
Definition
DNA polymerase III, delta subunit (EC:2.7.7.7)
Orthology
K02340  
DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cbc00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cbc00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:cbc03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:cbc03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cbc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1240607..1241626
Genome map
AA seq 339 aa AA seqDB search
MQLLQKQLDNHLNRQALLPLYLISGDVPLLVQETRDTIREAARQKGFHQCELLFVETGFH
WQSLTQSFDNFSLLSDKTLIELRNPKAKFDESGTQALLQYLNNPPEDKRLIIITNKLTAA
QQKTKWYKVIDRSGAVISLWPLSGQSLLAWIEQRLKKAGLEADNESISLLAELTEGNLLA
THQAIEKLRLLHQDESITPKAIIGVVNDNARFTIFDLTQAALMGAKSRVVRILANLYFAD
KEAGLLILWAITRELRLLYPLAIDYQRGKPLTELLASQWQTRKQPLRTALMRLNTTIIAQ
LLQQAKRIDHILKGLTPGNAWQELETLSLRMAGVEKGLL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcctacaaaaacagctcgacaaccatttaaaccgacaagcgcttcttcccctt
tatctcatttccggagacgtcccgcttctcgtccaggaaacacgcgacaccattcgcgaa
gcagctcggcaaaaaggcttccatcagtgtgaattattatttgttgaaacgggattccat
tggcaaagcctaacgcaatctttcgataacttcagtttattaagcgataaaacgcttatt
gaacttcgcaatcccaaagcaaaatttgatgaatcaggaacacaagctttattacagtac
ctcaacaacccacccgaggataaacgcttaataattattactaataaattaacggccgct
caacaaaaaacaaaatggtataaagtcatcgaccgttcaggcgccgtaatttccctttgg
cctttgtcaggacaatcgctactggcttggattgaacaacgcttaaaaaaagcaggctta
gaagccgataatgaaagtatttctcttctcgctgaattaactgaaggtaatttattagcc
acacaccaagctatcgaaaaattacgccttcttcaccaagacgaatctatcactcccaaa
gcgattatcggggttgttaacgataacgcacgattcaccatttttgatctcacacaagcc
gccttaatgggcgcaaaatcccgtgtcgttcgcattttagcgaatttatattttgccgac
aaagaagcgggattgctgatattatgggccataactcgcgagttgcgtctgctgtaccca
ctggccattgactatcagcggggtaagccgctcaccgaacttctcgcttcccaatggcaa
acacgtaagcagccgctaagaacggcgttaatgcgcttaaataccacgattatcgctcaa
ctcttacaacaagcaaaacgcatcgaccatatcctcaaaggcttaacgccgggcaatgcc
tggcaggaattagaaacattaagtttacgcatggccggggttgaaaaggggctcctttaa

DBGET integrated database retrieval system