KEGG   Coxiella burnetii CbuK_Q154: CbuK_1341Help
Entry
CbuK_1341         CDS       T00788                                 

Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbuK_1341
   01230 Biosynthesis of amino acids
    CbuK_1341
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuK_1341
   00030 Pentose phosphate pathway
    CbuK_1341
   00051 Fructose and mannose metabolism
    CbuK_1341
  Energy metabolism
   00680 Methane metabolism
    CbuK_1341
Enzymes [BR:cbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CbuK_1341
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CbuK_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1306070..1307092)
Genome map
AA seq 340 aa AA seqDB search
MLQAVQQSLQKNIDSGLLIDGLVTFTGDDIAIICSHQQGLNNEDVHVGFAWQAFLAATEV
AKEQGNYGAGQDLLVDAPSGNVRGAGPGVAEIEFTLNPKSNYRPAESFMIFAGDKCAPGA
FNLPLYLVFCDPMHNGGILLNPKIHLGWVFTVIDMDYKGEDEDRIIQLSVPERSWDVAAL
LQNPDRYAVESIRSRYKPEEQVVSVSATRLHNIAGKYTGKDDPIAIIRSQGIFPAPEEII
EPYSTINQIISGDARGSHNMPQLPVPINTPVTGPYCHPLISALGFSMNKQGKFAGRYVDF
FAGSAWDYARYVSQRRAAEIRRQGFMGIAMAQEAEIATLD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctacaggctgttcagcaatcccttcaaaagaatatcgactccggattattgatcgat
ggattggtaactttcactggcgatgatattgcgattatttgttcacatcaacagggttta
aataatgaagacgttcatgtcggttttgcgtggcaagcttttcttgcagcaactgaagtg
gcgaaagagcaaggcaattacggcgctggccaggatttactcgtggatgcgccttctggc
aatgttcgaggcgctggacctggtgttgctgaaattgaatttacccttaatccaaaatcc
aattaccgtccggctgaatcctttatgatatttgcaggtgataagtgcgcacccggcgca
tttaatcttcctctttatttagttttttgtgatccgatgcataatgggggaattttatta
aatccaaaaatacatttaggctgggtgtttacggtgattgatatggattacaaaggggaa
gacgaagatcgtattattcagctttctgttcccgaacgctcctgggacgttgccgcgttg
ttgcaaaatcccgatcggtatgcggttgaatccattcgctcacgttataaacctgaagaa
caagtggtttctgtttctgccacgcgattgcataacattgcaggaaaatacacaggcaag
gatgatccaattgctattattcgcagtcaaggtatttttccggcacctgaggaaattatt
gagccgtattcgactattaatcaaattatcagcggcgatgcgcgcggctctcataacatg
ccgcaattaccggttcctattaatacgcctgttactggaccgtattgtcatcccctaatt
tcggcacttggtttttccatgaataagcagggtaaatttgctggacgttatgtggatttt
tttgcgggttctgcttgggattacgcgcgttatgtttcccagcgtcgagcggccgaaatt
aggcggcaaggatttatgggcatcgctatggcgcaggaagcagaaattgctacactggat
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system