KEGG   Coxiella burnetii CbuK_Q154: CbuK_1341Help
Entry
CbuK_1341         CDS       T00788                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00010  Glycolysis / Gluconeogenesis
cbc00030  Pentose phosphate pathway
cbc00051  Fructose and mannose metabolism
cbc00680  Methane metabolism
cbc01100  Metabolic pathways
cbc01110  Biosynthesis of secondary metabolites
cbc01120  Microbial metabolism in diverse environments
cbc01130  Biosynthesis of antibiotics
cbc01200  Carbon metabolism
cbc01230  Biosynthesis of amino acids
Module
cbc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuK_1341
   00030 Pentose phosphate pathway
    CbuK_1341
   00051 Fructose and mannose metabolism
    CbuK_1341
  Energy metabolism
   00680 Methane metabolism
    CbuK_1341
Enzymes [BR:cbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CbuK_1341
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CbuK_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ACJ20518
Position
complement(1306070..1307092)
Genome map
AA seq 340 aa AA seqDB search
MLQAVQQSLQKNIDSGLLIDGLVTFTGDDIAIICSHQQGLNNEDVHVGFAWQAFLAATEV
AKEQGNYGAGQDLLVDAPSGNVRGAGPGVAEIEFTLNPKSNYRPAESFMIFAGDKCAPGA
FNLPLYLVFCDPMHNGGILLNPKIHLGWVFTVIDMDYKGEDEDRIIQLSVPERSWDVAAL
LQNPDRYAVESIRSRYKPEEQVVSVSATRLHNIAGKYTGKDDPIAIIRSQGIFPAPEEII
EPYSTINQIISGDARGSHNMPQLPVPINTPVTGPYCHPLISALGFSMNKQGKFAGRYVDF
FAGSAWDYARYVSQRRAAEIRRQGFMGIAMAQEAEIATLD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctacaggctgttcagcaatcccttcaaaagaatatcgactccggattattgatcgat
ggattggtaactttcactggcgatgatattgcgattatttgttcacatcaacagggttta
aataatgaagacgttcatgtcggttttgcgtggcaagcttttcttgcagcaactgaagtg
gcgaaagagcaaggcaattacggcgctggccaggatttactcgtggatgcgccttctggc
aatgttcgaggcgctggacctggtgttgctgaaattgaatttacccttaatccaaaatcc
aattaccgtccggctgaatcctttatgatatttgcaggtgataagtgcgcacccggcgca
tttaatcttcctctttatttagttttttgtgatccgatgcataatgggggaattttatta
aatccaaaaatacatttaggctgggtgtttacggtgattgatatggattacaaaggggaa
gacgaagatcgtattattcagctttctgttcccgaacgctcctgggacgttgccgcgttg
ttgcaaaatcccgatcggtatgcggttgaatccattcgctcacgttataaacctgaagaa
caagtggtttctgtttctgccacgcgattgcataacattgcaggaaaatacacaggcaag
gatgatccaattgctattattcgcagtcaaggtatttttccggcacctgaggaaattatt
gagccgtattcgactattaatcaaattatcagcggcgatgcgcgcggctctcataacatg
ccgcaattaccggttcctattaatacgcctgttactggaccgtattgtcatcccctaatt
tcggcacttggtttttccatgaataagcagggtaaatttgctggacgttatgtggatttt
tttgcgggttctgcttgggattacgcgcgttatgtttcccagcgtcgagcggccgaaatt
aggcggcaaggatttatgggcatcgctatggcgcaggaagcagaaattgctacactggat
tag

DBGET integrated database retrieval system