KEGG   Coxiella burnetii CbuK_Q154: CbuK_1371Help
Entry
CbuK_1371         CDS       T00788                                 

Definition
phospholipase A1 (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cbc00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:cbc00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:cbc00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1332560..1333594
Genome map
AA seq 344 aa AA seqDB search
MGKAIRKVGLFVIGILVILPFQSGAHTHTKTTSQLKNSRNDCRHIKRYDKKTKHYYNVVV
CKHATPPPPSFEEKLQEILSNLTPAQQSLLEKRLARQRQVTKTRAGISFYEPTYILPYYY
TGRPYHSIYEGNTPENQQLDHQEFKGQMSFQFPIWYDMFGSNLSLDISYTQLSYWQFYAK
SQFFRETNYQPQLFLSDHFSPNGLAAIGINHQSNGRGGNLERSWNRLFLDFTFTGAHWMV
DVKPWILIFKAESSDLHNPDIYRYLGYGRVVFAVTFHRQVLSLMLRNTVESGFKRGAIEL
SYSFPIHGLLHGYIQFFSGYGQSLIEYNHYTNSVGVGIIISNWI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagccatcagaaaagtgggattattcgtcatcggcattttagtcatcctacct
tttcaaagcggcgcccatactcatactaaaactacttctcaactaaaaaactcgagaaac
gactgtcgccatatcaagcgatacgataaaaaaaccaagcattactacaatgttgttgtt
tgcaaacacgccactcctccaccaccttcttttgaggaaaaattacaggaaatcttaagc
aacctgacgcccgctcaacaatccctcctcgagaagcgattggcacggcaacgacaagtt
acaaaaacacgcgcaggaatttctttttacgaaccgacgtatattttgccttattattat
accggtcgaccttatcactctatctatgaaggaaatactcctgaaaatcaacaattggat
catcaagaattcaaaggtcaaatgagcttccaatttccgatatggtatgacatgttcggt
agtaatctttcgttggatatatcctacactcagctctcttactggcaattttatgctaaa
tcccaattttttcgtgaaaccaattatcagccgcaattatttttaagcgatcatttttct
ccaaacggattagccgctattggcattaatcaccaatctaacggccgcggcggtaacttg
gaaagaagctggaatcgactttttctcgattttactttcaccggcgcccattggatggtt
gacgtcaaaccctggattttaatctttaaagcggaatccagcgatcttcacaatcccgat
atttatcgctacctcggctacggacgggttgttttcgcagtcacttttcatcggcaagtt
ctctctttaatgctgagaaatactgtcgaaagtggcttcaaacgcggcgctattgaactt
tcctattccttccccatccacggcctgttacatggctatattcaatttttcagtggttat
ggccaaagcttgattgaatacaatcattatacaaatagcgttggcgtgggaattattatc
agcaattggatttag

DBGET integrated database retrieval system