KEGG   Coxiella burnetii CbuK_Q154: CbuK_1470Help
Entry
CbuK_1470         CDS       T00788                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbuK_1470 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CbuK_1470 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CbuK_1470 (sucB)
Enzymes [BR:cbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CbuK_1470 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1422023..1423240)
Genome map
AA seq 405 aa AA seqDB search
MAIEIKVPTLPESVSDATVAKWYKKEGDSISRDENLVDLETDKVMLEVPAPKDGVVEKIV
AKEGEVVKADQILALLKEGGAVAKEKEKKDEKETKKEKEKKEEKKDKEKKEKTEEKESDL
SPAVRRMVSEKDVDVEEIEGSGKGGRITKKDVEDYLEKQKEKPSEGKEGPADERTEKRVP
LSRIRQRIAERLVQVQQEAALLTTFNEINMQPVMELRKKYREEFEKKFKVRLGFMSFFTK
AVVEALKRFPMVNASIDGSDIIYHNYYDIGIAIGTERGLIVPILRNAEKMNMADIEKQIR
EYASRAQEGRLNIEELTGGTFTITNGGTYGSLLSTPIINPPQTAILGMHKIMDRPTVENG
EVVVRPIMQVALSYDHRVIDGREAVLFLVTIKELLEDPARMILEC
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctatagaaattaaagtacctacgttgcctgaatcggttagcgatgccacggttgca
aagtggtataaaaaagaaggcgattccatttcacgggatgaaaatctagtcgatttggaa
acggataaagtcatgttggaggttcccgccccgaaagacggtgtggttgaaaaaatcgtc
gcgaaagaaggcgaagtcgttaaagccgatcaaatccttgcccttttaaaagaaggcggc
gctgtggccaaagaaaaagaaaagaaagacgaaaaagaaacgaaaaaagaaaaagagaaa
aaagaagaaaagaaagataaggaaaaaaaggaaaaaactgaagaaaaagaatctgatctc
agtcccgccgtgcgacgtatggtttcggaaaaagacgttgatgtcgaggaaattgaagga
agtggaaaaggagggcggattacgaaaaaagacgtggaagattatttagaaaaacaaaaa
gagaaaccctccgaaggaaaagaagggcctgccgatgaacgcacggaaaaacgcgtgcct
ttatcccgcatccggcaacgtattgcggagcggttagtgcaagtccaacaagaagcggct
ttattaacgacgtttaatgaaattaacatgcagccggtaatggagttgcgaaaaaaatac
cgcgaagagttcgaaaagaaattcaaagttcgattgggttttatgtccttttttaccaaa
gccgtcgttgaagcgttaaaacgttttcccatggtaaacgcctcgatcgatggtagtgat
attatttatcacaattattacgacatcggtattgctattggcactgaacgcggattaatt
gtccctattcttagaaacgccgaaaaaatgaatatggccgatattgaaaaacaaattcgt
gaatacgcttctcgagctcaagaaggtcgtttgaatattgaggaactaacgggaggcact
tttacaattacgaatggcggaacttacggctcgcttctctcaacgcctataattaatccg
ccccaaaccgctattttggggatgcataaaataatggaccgtccaacggttgaaaacgga
gaagtcgtggttcgtccgatcatgcaagtggcattatcttacgatcatcgggtgattgac
gggcgagaagccgtgttatttttagtgaccattaaagagcttttggaagatccagctcga
atgattttggagtgttaa

DBGET integrated database retrieval system