KEGG   Coxiella burnetii CbuK_Q154: CbuK_1474Help
Entry
CbuK_1474         CDS       T00788                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00020  Citrate cycle (TCA cycle)
cbc00190  Oxidative phosphorylation
cbc00650  Butanoate metabolism
cbc01100  Metabolic pathways
cbc01110  Biosynthesis of secondary metabolites
cbc01120  Microbial metabolism in diverse environments
cbc01130  Biosynthesis of antibiotics
cbc01200  Carbon metabolism
Module
cbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cbc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CbuK_1474 (sdhD)
   00650 Butanoate metabolism
    CbuK_1474 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    CbuK_1474 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF1211 CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ACJ20641
Position
complement(1428592..1428939)
Genome map
AA seq 115 aa AA seqDB search
MDMVDRISRRGYRDWFVQRITALLSGIYAVFVIVFLLVHHPISYPQWHALFSHLIMKIFT
LIVIFSILWHAWIGMWTIFTDYVKNKPIRLALETLVCLLLVGYFVWAIEFLWIAR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
gtggatatggtagataggatcagccgtcgcggctatcgtgactggttcgttcagcggatt
accgccttattaagcggtatttatgcggtttttgtcattgtttttttgctcgtccaccat
cccatttcttaccctcagtggcacgcattatttagtcatttaataatgaaaatattcacc
ctcatcgttattttcagcattttatggcacgcctggattggcatgtggacaatctttacc
gattatgtaaaaaacaaacccatacggctcgctttagagactctggtttgtttattgtta
gtgggctatttcgtatgggccatcgaatttttgtggatagcgcgttga

DBGET integrated database retrieval system