KEGG   Coxiella burnetii CbuK_Q154: CbuK_1536Help
Entry
CbuK_1536         CDS       T00788                                 

Gene name
sepB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cbc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1481779..1482660)
Genome map
AA seq 293 aa AA seqDB search
MKCLPPEKAFLGLEPQKAVPYEKAKAVIIPFGLERSVSYGGGTAQGPAAMIEASFEVELF
DEALWCEPYCDIGIVTLEEPKIEADMQSALKQLETLVQQVLDDEKFPFVFGGEHSITAGS
IRPFVNAYDNLAILHFDAHADLRDGYEGEHYSHASAIRRCLDYPSVEVISVGIRNISAEE
IPFFEANRNRIHIYWAKDKKTWDINEIIAPLKNRPIYLTFDLDGFDASLMPATGTPEPGG
LFWNDAQEIITAAGQVGTIVGADINELAPIPGFHSCDFLAAKLAYKILSSAFK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcctccctcctgaaaaagcctttttaggactcgaaccgcaaaaggccgtccct
tatgaaaaagccaaagcggtgatcattccttttgggcttgaacgttcggtcagctatggg
ggagggacggcacaagggccggcggcaatgattgaagcgtcttttgaagtggaattattt
gatgaagcgctttggtgcgaaccttattgcgatatcggcatcgtgacgttggaagaacct
aaaatcgaagctgatatgcaaagcgcattgaaacaactggaaacgttagtgcaacaggta
ttagatgacgaaaaattccccttcgtttttggaggcgagcattccataacggcgggttct
attcgcccatttgtgaacgcctatgataacttagcgattttacattttgatgctcatgca
gatttgcgcgatggttatgaaggcgagcattattcgcacgcctctgctattagacgctgt
ttggattatcctagtgtggaagtcatttcagtgggtattcgaaatatttcagcggaagaa
attcccttttttgaagccaaccgcaatcgcattcatatttattgggcgaaagataaaaaa
acttgggatattaatgaaatcattgcgcctttaaaaaatcgccctatttatctgactttc
gatcttgacggttttgatgcaagcttaatgcctgccactgggacccccgaacctggcggc
cttttttggaatgacgctcaagaaattattactgcggccggtcaagtgggcactattgta
ggcgctgatattaatgaattagcacctatccctggattccacagttgcgattttttagcc
gcaaaattagcttacaaaattctttcatccgccttcaaatag

DBGET integrated database retrieval system