KEGG   Coxiella burnetii CbuK_Q154: CbuK_1553Help
Entry
CbuK_1553         CDS       T00788                                 

Gene name
cysQ1.2
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7 3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cbc00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1496386..1497219
Genome map
AA seq 277 aa AA seqDB search
MIKMEAFIYSEKMLTSVIEIIKFAAKKILSIYSEPTSLVVTKKGDGSPLTKADQLTHDFI
SAQLTNLTPKIPIISEELDFEIYSNTLLNSYFWLVDPLDGTKDFIKRNGEFTVNIALIKD
AKVVLGVVFVPVTNTCYYANKVVGAFKQVGEQPPQQLQLTPQNKARDLNQPIKVAISRHH
GLDGIQKFIDKIGPCECVSMGSSLKICSLAEGEVDIYPRLGPTKEWDTAAAQCVLEQAGG
KILIETGKSLFYNKLDFLNPKFLALGSRGNPAWVTYL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattaagatggaagccttcatttatagtgaaaagatgttgacatctgtgatcgaaata
atcaagtttgctgcaaaaaagattcttagtatctatagtgaacccacttctttagtagtg
acaaagaaaggcgatggttccccgttaacaaaagctgatcaattgacacatgattttatt
tcagcgcaactcactaatttaaccccgaagattcccatcatttccgaagagttagatttt
gagatttattctaacacccttctaaattcttatttttggttggttgatcctttagacggg
accaaagactttattaaacgcaatggcgaatttactgttaatatagccttaatcaaagat
gcgaaagtagtactcggggtagtgtttgttcctgtaaccaacacttgttattatgcaaat
aaagtagttggcgccttcaagcaagttggagaacaaccaccccaacaattacaattgacc
ccgcagaacaaagcaagggatttgaatcaacctatcaaagtcgcaataagtcgccaccat
ggacttgatggcatacaaaaatttattgataaaattggtccttgcgagtgtgtcagcatg
ggcagtagcttgaagatatgctcgttagcagaaggggaagtagacatctacccgagatta
ggtcctacgaaagagtgggatacggctgcagcgcaatgcgttttagaacaagcgggcgga
aaaattctgattgaaaccggaaaatcattattttacaataaattggattttttaaatcca
aaattcttggctcttggtagtaggggaaatccagcttgggttacctatttataa

DBGET integrated database retrieval system