KEGG   Coxiella burnetii CbuK_Q154: CbuK_1602Help
Entry
CbuK_1602         CDS       T00788                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cbc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1545492..1546097
Genome map
AA seq 201 aa AA seqDB search
MFSPLTKQLIEALQCLPGIGPKSAQRMAFHLLAKSGQAKGLALSDALQSAIRQVGECKLC
QIYTEQPLCNICNNPKRDSTLLCVVESPADVVAIEQTQIYSGRYFVLHGHLSPLDGIGPQ
EIGIPALLDRLRNETIKELIIATNATMEGKATAHYVANHIDHTKIKCSRIAHGVPMGGEL
EYLDGGTLIHALHSRIPVEDN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgttcagcccgctgacaaaacaactcatcgaagcattacaatgcttgccgggaataggc
ccaaaatccgcgcaacgaatggctttccatcttcttgcgaaatcaggacaagccaaagga
ttggcattgtccgatgccctccaatcagccattcgtcaggtaggtgaatgtaaattatgt
caaatttacacggaacagcccctttgcaacatctgcaataatcctaaaagggattccacg
ttgctttgtgtcgtcgaaagccctgctgacgttgtggccattgaacaaactcaaatttat
tcggggcgttattttgtcctccacggacatctttcgccactagacggcatcgggccccaa
gaaataggaattccagctttgctcgatcgcttgcgcaatgaaacgattaaagagctgatc
attgcaaccaatgccaccatggaaggcaaagcgacagcccactatgttgcaaatcacatc
gatcacactaaaataaaatgttcgcgcatcgctcacggggtgccgatgggtggcgaattg
gaatatctcgatggtggcacgttaatccacgctttacactcccgaattccagtcgaagat
aactaa

DBGET integrated database retrieval system