KEGG   Coxiella burnetii CbuK_Q154: CbuK_1618Help
Entry
CbuK_1618         CDS       T00788                                 

Gene name
pdhC.2
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbuK_1618 (pdhC.2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuK_1618 (pdhC.2)
   00020 Citrate cycle (TCA cycle)
    CbuK_1618 (pdhC.2)
   00620 Pyruvate metabolism
    CbuK_1618 (pdhC.2)
Enzymes [BR:cbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CbuK_1618 (pdhC.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1559828..1560964
Genome map
AA seq 378 aa AA seqDB search
MKVFKLPDLGEGLPDATIREWYIAVGDEVKIDQPLVAMETAKALVDVPSPLASKIEKLFG
EVGDVIETGSPLIGFEGEAETEEPKDTGTVVGAIETSDTVLEESGAGIPVKKAAEKKNFK
ATPAVRMLAKQLGVDLTKITPKGSLISAEDVKQAAQITKTGKTQKIEGELTPLSPVRRAM
AQSMSQSHREVVPVSLMDDGDLSAWKGEQDITLRIIRAIEAACQAVPIMNAHFDGETLGY
KLNETINIGIAVDTPQGLYVPVLKDVSHQDDTALRNQINRFKELAQSRSFPPEDLRDATI
MLSNFGAFAGRYANPILLPPMVTIIGVGRTRDEIVPVDGKPAVHRILPLSVTSDHRVITG
GEIARFLKQLIDSLEKAS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttttaaattacctgatcttggagagggattgcccgatgccaccattcgagaa
tggtatatcgccgtgggagatgaagtgaagatcgaccagcctttagtggctatggaaaca
gcaaaagcattggtggacgtcccctctcccttggctagcaagatcgaaaagttatttggt
gaagttggcgatgttattgaaacgggaagtcccttgattggatttgaaggcgaagctgaa
accgaagaacctaaagataccggcactgtggttggagctattgaaacaagcgacactgtt
ttggaggaatcaggcgcgggtatccccgttaaaaaagcggctgagaaaaaaaattttaaa
gccacacccgccgttcgtatgttagccaaacaattgggcgttgatcttaccaagatcaca
cctaaaggctccctaatttctgccgaagatgtcaagcaagccgcccaaattaccaaaacg
ggtaagacccaaaaaattgaaggagaactaacaccgttatctcccgtacgccgggccatg
gcccaaagcatgtctcaatcccatcgagaggtcgttcccgtgagcttaatggatgacggc
gatttatctgcctggaaaggcgaacaagatatcactctgcggattatccgcgcaatcgaa
gcggcttgccaagcagtgcccattatgaacgctcatttcgatggtgaaactctgggttat
aaactgaatgaaacgattaatattggaatagccgtggatactcctcaaggactgtatgtt
cccgtattaaaagatgtcagccatcaggatgacacggcgcttcgcaaccaaattaatcgc
ttcaaagaactcgctcaaagccgcagcttcccgccggaagatctgcgcgacgctacgatc
atgctttctaattttggcgcttttgcgggacgttatgccaatcctattctcttgccacct
atggtgaccattatcggtgttggccgcacccgggatgaaatcgtgcctgttgatggcaaa
cccgctgtccatcggatattgccgctttcagtaacaagcgatcatcgagtaattaccggg
ggcgaaatcgcccggtttttgaagcagctaattgattcgctcgaaaaagcttcctga

DBGET integrated database retrieval system