KEGG   Coxiella burnetii CbuK_Q154: CbuK_2122Help
Entry
CbuK_2122         CDS       T00788                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CbuK_2122 (hemD)
Enzymes [BR:cbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CbuK_2122 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2043637..2044443
Genome map
AA seq 268 aa AA seqDB search
MENESLKNKTIMITRPEGQGELLKKAIERRGGAVILFPTLIIKPINKCNYSPFASASFPP
SRESGSPDDKMTKAGFLNSSDILIFLSANAVKHSPILNFKAEQKLVAIGTGTAAALFQRG
LSVDAVPEHFSSEGLLDLPLLHQVTGKTIAIFCGENSRPYLENELIHRGANVFSIITYRR
ERPVVNKKTIDALTHQTLHAIVSTSAESLQNLCTLFESHQHWLHRIPLVVISKRMENLAK
SQGFHLVLLADNPGEKAIIKVLSTKYPS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgaatccttaaaaaataaaaccatcatgatcactcgccctgaagggcaggga
gaattattaaaaaaagccattgaacgtaggggaggcgccgttattttatttccaaccctt
attataaaaccaattaataaatgcaactactcgcccttcgcatccgcaagttttccacct
tcccgcgaaagcgggagtccggatgataaaatgactaaggctggatttctgaattcaagc
gacatcctcatttttctaagtgcaaatgctgtaaaacattctcctattttaaattttaaa
gcggaacaaaaattagttgctattggcacaggtaccgccgcggctttatttcaacgcgga
ctttctgttgatgccgttcccgaacatttcagtagtgaaggccttttagatttgccttta
ctccatcaggtgactggaaaaacaattgctattttttgcggcgaaaactctcgcccttat
ttagaaaacgaacttatccatcgcggcgcaaatgtattctccattattacttaccgacga
gaaagacctgtcgtcaataaaaaaacgattgacgcactcactcaccaaacgcttcatgca
attgtctccactagcgccgaaagcctccaaaatctctgcaccttattcgaatcacaccaa
cactggttacaccgtatcccgctcgttgtcattagcaaaagaatggaaaacttagcaaaa
tctcaagggttccacttggtgcttctagcagacaatcctggagaaaaggctattataaag
gttttatccactaaatatccgagttaa

DBGET integrated database retrieval system