KEGG   Coxiella burnetii CbuK_Q154: CbuK_2145Help
Entry
CbuK_2145         CDS       T00788                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00240  Pyrimidine metabolism
cbc00250  Alanine, aspartate and glutamate metabolism
cbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CbuK_2145 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CbuK_2145 (pyrB)
Enzymes [BR:cbc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CbuK_2145 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACJ21235
UniProt: B6J6M5
Position
2062086..2063018
Genome map
AA seq 310 aa AA seqDB search
MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVVNLFFEPSTRTR
NSFEIAAKRLGAMVLNPNLKISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAK
QLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCVTIIGDIRHSRVANSLMDGLV
TMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF
RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLE
LFLLRDFRFF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacttcctttacatttattgaatatgcgctcactcacgcgcgaccatattgaa
aaactcatccaacgggcgaattattttttaactcagggcatggaaaaaaattcggtcttt
gaaacattaaaagggcacgtagtcgtcaacttattttttgaacccagcacacgaacgcgc
aactcctttgaaattgcggcaaaacgtttgggcgccatggttcttaaccctaatcttaaa
atttcggcaataagtaaaggtgaaactctttttgatacgattaaaactttggaagcgatg
ggtgtttattttttcattgtacgccattctgaaaatgaaaccccggagcagatagcaaaa
caattatcctcaggcgtcgtcatcaacgcgggtgacggtaatcatcaacatccctcacaa
gctttaattgatttaatgacaataaagcaacacaaaccccattggaataaattgtgcgtc
acgattattggcgatattcgtcattctcgcgtggcaaactcattaatggacggcttagtc
acgatgggcgttccggaaattcgattggtaggcccatcgtcattattgccggacaaggtc
gggaacgactcgattaaaaaattcaccgaattaaaaccaagtctccttaacagcgacgtt
attgtcacccttcgtttgcaaaaggaacgccatgataattctgtcgatatcgatgctttt
cgcggatcttttcgattgacacctgaaaaattatattccgcaaaacccgatgccattgtt
atgcatccgggtcccgtcaaccgcgaagtcgaaattaattctgatgtcgcagataaccaa
caatctgtcatccttcaacaagtacgtaacggcgtcgctatgcggatggctgtgttggaa
ttatttttgttgcgagattttcgatttttttga

DBGET integrated database retrieval system