KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_0068Help
Entry
CBUD_0068         CDS       T00583                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:cbd00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:cbd00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(66359..66928)
Genome map
AA seq 189 aa AA seqDB search
MPFEFQKMPIPEVILIKPKVFTDDRGFFIETFKQSDFRRHGINGEFLQDNHSLSMKKGVL
RGLHYQLDPHAQGKLVRVVLGKVFDVAVDLRRESPTFGKWVSTELSSTNNHMLWIPPGFA
HGMLVLEENTHLLYKCTAEYVPESERYIRWDDPDINIKWPIKNNLLLSEKDAAGVFLQRA
EINAQYHGS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgaatttcaaaaaatgcctattcctgaagtcattttgattaaacccaaagtt
tttacggatgaccgaggcttttttatagaaaccttcaagcaaagcgattttaggcgccat
ggtattaatggggaatttttgcaagataatcattctttatcaatgaagaaaggcgtattg
agaggattacattaccaactggaccctcatgcgcaaggaaaattagtgcgtgtggtttta
ggtaaagtattcgatgtagccgttgatttacgacgggaatcaccgacattcggaaaatgg
gtttccacagaactttcttctaccaataatcacatgctctggatacctcctggttttgct
catggtatgctggtattggaggaaaatacacatttattatataagtgcacagcagagtat
gttcccgaatcagagagatacattcgttgggacgaccctgacattaatattaagtggccg
atcaaaaataatcttttgctttctgaaaaggatgcggcgggggtatttttgcaacgggca
gaaattaacgcgcaataccacgggagttga

DBGET integrated database retrieval system