KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_0542Help
Entry
CBUD_0542         CDS       T00583                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd00010  Glycolysis / Gluconeogenesis
cbd00051  Fructose and mannose metabolism
cbd00562  Inositol phosphate metabolism
cbd01100  Metabolic pathways
cbd01110  Biosynthesis of secondary metabolites
cbd01120  Microbial metabolism in diverse environments
cbd01130  Biosynthesis of antibiotics
cbd01200  Carbon metabolism
cbd01230  Biosynthesis of amino acids
Module
cbd_M00002  Glycolysis, core module involving three-carbon compounds
cbd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBUD_0542 (tpiA)
   00051 Fructose and mannose metabolism
    CBUD_0542 (tpiA)
   00562 Inositol phosphate metabolism
    CBUD_0542 (tpiA)
Enzymes [BR:cbd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CBUD_0542 (tpiA)
Exosome [BR:cbd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CBUD_0542 (tpiA)
  Exosomal proteins of bladder cancer cells
   CBUD_0542 (tpiA)
  Exosomal proteins of melanoma cells
   CBUD_0542 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABS77929
UniProt: A9KBK2
Position
522021..522836
Genome map
AA seq 271 aa AA seqDB search
MIPLEWRQISAWRGCHMQRRPLVAGNWKMHGSRESVGQLLRALKHGCERLETAELAVFPP
FVFLQQCEEALMRTQISWGAQDVSEFERGAYTGEVSAAMLRDFHCRYVIVGHSERRQRHG
ETNEQVAAKVRAALRCGIRPIICVGETEKQRNANQTLSVIKEQLAVVLQMNDNLASLEGM
VVAYEPIWAIGTGKNATPSQAEEVHAALRDQLHRQDATLAESTRLLYGGSVKPDNAAALF
EMPNIDGALVGGASLEAEQFLKIGQQCNQSF
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgattccgctagaatggcgccagatttcagcatggagaggatgtcatatgcagcgtcga
ccgttagtggctggtaattggaaaatgcatggttcgcgcgaaagtgtgggtcaattatta
agggcattaaaacacggttgcgagcgtctggaaacggcggagctcgctgttttcccccct
tttgtctttttgcagcaatgcgaagaggcgctgatgcgaacgcaaatctcttggggtgcg
caggacgtttccgaattcgaaagaggcgcttatacgggggaagtctctgctgccatgctg
cgcgatttccattgccggtatgtaatcgtcggccactcggaaaggcgtcagcgtcacgga
gaaaccaatgagcaagtggctgcgaaggttagggcagccctccgttgcggcattcgtccc
attatttgtgtaggggaaactgaaaagcagcgcaatgctaatcagacattatcagtgata
aaagagcaacttgcagttgtattgcagatgaacgataatttggcgtcgttggaaggcatg
gtggtggcttatgagccgatatgggcgattggaaccggaaaaaatgcaacgccttcgcaa
gcagaagaagtgcacgcagcccttcgagatcaattacaccgtcaggatgcgacactagcc
gaaagcacgcggcttttatatgggggcagtgttaagccggataatgcagccgctttgttt
gaaatgccaaatatagatggcgctttagtgggtggggcttctttggaagctgaacaattt
ctaaaaatagggcaacaatgcaatcaatcattttaa

DBGET integrated database retrieval system