KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_0542Help
Entry
CBUD_0542         CDS       T00583                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBUD_0542 (tpiA)
   01230 Biosynthesis of amino acids
    CBUD_0542 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBUD_0542 (tpiA)
   00051 Fructose and mannose metabolism
    CBUD_0542 (tpiA)
   00562 Inositol phosphate metabolism
    CBUD_0542 (tpiA)
Enzymes [BR:cbd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CBUD_0542 (tpiA)
Exosome [BR:cbd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CBUD_0542 (tpiA)
  Exosomal proteins of bladder cancer cells
   CBUD_0542 (tpiA)
  Exosomal proteins of melanoma cells
   CBUD_0542 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
522021..522836
Genome map
AA seq 271 aa AA seqDB search
MIPLEWRQISAWRGCHMQRRPLVAGNWKMHGSRESVGQLLRALKHGCERLETAELAVFPP
FVFLQQCEEALMRTQISWGAQDVSEFERGAYTGEVSAAMLRDFHCRYVIVGHSERRQRHG
ETNEQVAAKVRAALRCGIRPIICVGETEKQRNANQTLSVIKEQLAVVLQMNDNLASLEGM
VVAYEPIWAIGTGKNATPSQAEEVHAALRDQLHRQDATLAESTRLLYGGSVKPDNAAALF
EMPNIDGALVGGASLEAEQFLKIGQQCNQSF
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgattccgctagaatggcgccagatttcagcatggagaggatgtcatatgcagcgtcga
ccgttagtggctggtaattggaaaatgcatggttcgcgcgaaagtgtgggtcaattatta
agggcattaaaacacggttgcgagcgtctggaaacggcggagctcgctgttttcccccct
tttgtctttttgcagcaatgcgaagaggcgctgatgcgaacgcaaatctcttggggtgcg
caggacgtttccgaattcgaaagaggcgcttatacgggggaagtctctgctgccatgctg
cgcgatttccattgccggtatgtaatcgtcggccactcggaaaggcgtcagcgtcacgga
gaaaccaatgagcaagtggctgcgaaggttagggcagccctccgttgcggcattcgtccc
attatttgtgtaggggaaactgaaaagcagcgcaatgctaatcagacattatcagtgata
aaagagcaacttgcagttgtattgcagatgaacgataatttggcgtcgttggaaggcatg
gtggtggcttatgagccgatatgggcgattggaaccggaaaaaatgcaacgccttcgcaa
gcagaagaagtgcacgcagcccttcgagatcaattacaccgtcaggatgcgacactagcc
gaaagcacgcggcttttatatgggggcagtgttaagccggataatgcagccgctttgttt
gaaatgccaaatatagatggcgctttagtgggtggggcttctttggaagctgaacaattt
ctaaaaatagggcaacaatgcaatcaatcattttaa

DBGET integrated database retrieval system