KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_0591Help
Entry
CBUD_0591         CDS       T00583                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd00020  Citrate cycle (TCA cycle)
cbd00190  Oxidative phosphorylation
cbd00650  Butanoate metabolism
cbd01100  Metabolic pathways
cbd01110  Biosynthesis of secondary metabolites
cbd01120  Microbial metabolism in diverse environments
cbd01130  Biosynthesis of antibiotics
cbd01200  Carbon metabolism
Module
cbd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cbd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBUD_0591 (sdhD)
   00650 Butanoate metabolism
    CBUD_0591 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    CBUD_0591 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF1211 CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ABS78118
UniProt: A9KBP8
Position
569267..569614
Genome map
AA seq 115 aa AA seqDB search
MDMVDRTSRRGYRDWFVQRITALLSGIYAVFVIVFLLVHHPISYPQWHALFSHLIMKIFT
LIVIFSILWHAWIGMWTIFTDYVKNKPIRLALETLVCLLLVGYFVWAIEFLWIAR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
gtggatatggtagataggaccagccgtcgcggctatcgtgactggttcgttcagcggatt
accgccttattaagcggtatttatgcggtttttgtcattgtttttttgctcgtccaccat
cccatttcttaccctcagtggcacgcattatttagtcatttaataatgaaaatattcacc
ctcatcgttattttcagcattttatggcacgcctggattggcatgtggacaatctttacc
gattatgtaaaaaacaaacccatacggctcgctttagagactctggtttgtttattgtta
gtgggctatttcgtatgggccatcgaatttttgtggatagcgcgttga

DBGET integrated database retrieval system