KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_0597Help
Entry
CBUD_0597         CDS       T00583                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBUD_0597 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBUD_0597 (sucC)
   00640 Propanoate metabolism
    CBUD_0597 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CBUD_0597 (sucC)
Enzymes [BR:cbd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CBUD_0597 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576366..577538
Genome map
AA seq 390 aa AA seqDB search
MNLHEYQSKHLLKKYNIPVPASEVVFNPDAAVDAAAKIGGDRWVVKAQVHAGGRGKAGGV
RLVKNKEELKSAVKALLGTRLVTYQTDERGQPVNQILVEQTSDIARELYLGAVIDRASQR
IVFMASTEGGVEIEKVAEKSPEKILKVTVDPAIGLQPFQCRQLFFGLGLQDLKQMRSFTD
IVMGLYRLFTERDLSLLEINPLVITGSGELICLDAKINIDDSALYRQSELREMRDTTQED
EHETMAQQWELNYIKLDGNIGCMVNGAGLAMATMDLIKLSGGDPANFLDVGGSATKERVT
EAFRIIVSDKNVKGILVNIFGGIVRCDLIADGIISAVKEVGIDVPVVVRLEGNNAQLGAK
KLADSSMNIIAAKGFADAAEQIVKQVGVIA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacatgaatatcaatcaaaacatttattaaaaaaatacaacatccccgttcct
gccagcgaagtggttttcaatcccgacgccgctgtcgatgcggccgctaaaatcggtggc
gatcgttgggttgtcaaagcccaagtgcatgccggaggtcgtggtaaagcgggtggtgtg
cgtttggtgaagaataaagaagaattaaaatcggccgtcaaggcattattaggcacgcgg
ttagtcacctatcaaaccgatgaacgtggccagccggtgaatcagatcctcgttgaacaa
acttctgatatagcacgggaattgtacctaggggcggtgattgatcgtgcttctcaacgt
atcgttttcatggcgtcgactgaaggcggtgtggaaattgaaaaagtcgctgaaaaatcg
cctgaaaaaatactaaaagttactgttgacccggccattggtttacaaccctttcaatgt
cgccaattattttttggtttagggctccaagacttaaaacaaatgcgctcattcaccgat
attgtgatgggcttataccgattatttaccgagcgcgatttaagcttattagaaattaat
ccattggtcatcactggttcgggtgaactcatttgtttggatgccaaaatcaatatcgat
gacagcgcgctttatcgtcaatccgaattgcgcgaaatgcgagacaccactcaagaagat
gagcatgaaacgatggcccaacaatgggaattaaattacatcaaactggatggcaatatc
ggttgtatggtaaacggtgctggacttgccatggcaacgatggatttaatcaaactgtcc
ggtggcgatcctgctaatttcctcgacgttggcggcagcgctactaaagaacgcgtgaca
gaagcgtttaggattattgtatcggataaaaatgttaaaggcattttagttaatattttc
ggtggtattgttcgttgcgatctcatcgctgacggaattatcagtgcagtaaaagaagtt
ggcattgatgtgccagtggttgttcggcttgaaggaaataatgctcagttgggtgcaaaa
aaattggcagatagtagcatgaatattatcgccgccaaaggatttgccgatgcagcggaa
caaattgtcaaacaagtaggggtgatcgcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system