KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_0718Help
Entry
CBUD_0718         CDS       T00583                                 

Definition
polysaccharide export ATP-binding protein
Orthology
K09691  
lipopolysaccharide transport system ATP-binding protein
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
ABC transporters
Module
Lipopolysaccharide transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:cbd02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
701868..702644
Genome map
AA seq 258 aa AA seqDB search
MQNYIELQSVSIEIPVFDANRSFRRSLANRLGGEINRNEKKKVYITALHDISFSLKKGDR
LGLIGHNGAGKTTLLRLLAHIYRPTKGQYICRGRVTSLFSINLGMDMDDTGLENIHTIGM
FLGMTKQELKKKQDEIIEFSELDDFIHLPLRTYSSGMLTRLSFALATALEPDILLMDEGI
GAGDANFAEKAKNRLNDFYKNINTLVLASHSDELIKKLCNKAILLEHGSIKAFGDVDEII
SVYRGKGALKKMNSVSCY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaattatattgagttacaaagcgtatctattgaaattcctgtttttgatgctaac
cggagtttccgtcggtctttagcaaaccgtttgggtggagaaattaatcgtaatgagaaa
aagaaagtttatataactgctttacatgatatttcattttctttaaagaaaggcgaccgt
cttggtttaattggccataacggcgctggtaaaacaaccttgttgagattgttggcgcat
atttatcgaccgactaaaggccaatatatttgtcgagggcgggtaacttcattattcagt
attaatttaggtatggatatggatgacacaggtctcgaaaatattcacaccattggtatg
ttcttgggaatgacaaagcaggagcttaaaaaaaagcaagatgaaattattgagtttagt
gaattggacgattttattcatttgcctttacggacttactcttcaggcatgttaactcga
ctgagttttgctctggcaacagcacttgagccggatattttattaatggatgaaggtatt
ggtgcaggtgatgcaaattttgcggaaaaagctaaaaatcgtctaaacgatttttataag
aacattaacactcttgttttggcatctcattccgatgaactaattaaaaaattgtgtaat
aaagcgatattattggagcatggtagtatcaaagcttttggcgatgttgatgaaattatt
tccgtttatcgaggcaagggtgcgcttaaaaaaatgaattctgtttcttgttattga

DBGET integrated database retrieval system