KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_0896Help
Entry
CBUD_0896         CDS       T00583                                 

Gene name
asnB2
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cbd00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
883538..885436
Genome map
AA seq 632 aa AA seqDB search
MCGIAGIFNLNGKPVAFDQIKAMTDSIAHRGPDGEGQFTDKYIGLGHRRLAIIDLSPAGH
QPMQTKDGRYLITYNGEVYNFKILRKELETLGYSFFSNTDTEVVLNAYVQWGEKCLEKFN
GMFAFAVWDRKEKTLFLARDRYGIKPLYYYQTNDCFVFASEIKAIIASGLYGAEINKEAL
VEYLTFQNFFTDRTLFKDVRIMPAGHFMMVKRENSSLHQYWDFNFTNDSALSEKMLLEKI
NDLFQQAVNRQLVSDVPVNSYLSGGVDSGSITMIAAKQLPHIRTFTVGFDLSSASGLELA
FDERQAAEHLSYLAGTEHYEMVLKAGDMERCMQDLVWHLEEPRIGQSYPNFYAAKLASKF
GKVVLAGTGGDELYAGYPWRYLCGQSSENFEDYIDKYYQYWQRLMSNKNLFKVLAPIAEE
VKSIWTRDIFANVFRIKDTPIKTEDYINYSLYFEAKTFLHGLLVVEDKLSMAHGLETRVP
CLDNDFVDFALQVPVKYKLSDFAFERVNENDTFSKREKRMNGKKILRKMMSRYVPDNVAH
APKQGFSAPDASWFKGESIEFVRSLLGDRNAKIFELLDYSVVNHLVNDHIQNHHNHRLLI
WSLIYFEIFMQVHLSKGHKSNYHLFTPETVEL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggtattgcaggcattttcaatttaaatggtaagccagttgctttcgatcaaatt
aaagcgatgacggattctattgctcatcgcggaccggatggcgagggacagtttactgac
aaatatatcggattgggacatagaagactggcgattatagatttaagtcccgcagggcat
caaccgatgcaaacgaaggatggtcgttatcttattacttataatggtgaagtttataat
ttcaaaatactgcgtaaagagttagaaactttgggctattcatttttttctaataccgat
acggaagtggttttaaacgcttatgtacaatggggagaaaagtgtttagaaaaatttaat
ggcatgtttgcttttgccgtttgggatcgcaaagaaaaaacattatttttagccagagac
cgttatggaattaaaccattatattattatcaaacaaacgattgcttcgtttttgcctct
gaaataaaggcgattattgcttcaggtctttatggcgctgagattaataaagaggctttg
gtagaatatttaactttccaaaatttctttacggatcgaacgctttttaaagatgtccgc
attatgcctgccggtcattttatgatggtaaaaagagaaaattcatctcttcatcaatat
tgggattttaattttacaaatgattcagcgctttctgaaaaaatgctattagaaaaaatt
aatgatttgtttcagcaagcggttaaccgccagcttgtcagtgatgttcctgtgaatagt
tatttaagcgggggggtggactcgggatcgattacaatgattgcagcaaaacaattgccg
cacatacgtactttcacagtagggttcgatttgagttccgcttctggtttggaattagca
tttgacgagcgtcaagcagccgaacatctttcttatcttgctggcactgagcattatgaa
atggtattaaaagcgggagatatggagcgttgcatgcaggatttggtgtggcatttggaa
gaaccgcggatcggacaaagttatccaaatttttacgcggctaaattggccagtaaattc
ggtaaagttgtattagctggaactggcggagacgagctttacgcaggatacccatggcgc
tatttgtgcggacagagtagcgaaaattttgaagattatattgataaatattatcaatat
tggcagcggttgatgagtaacaaaaatctttttaaagttcttgctcctattgctgaagaa
gtaaaatctatttggactcgagatatatttgctaatgtttttcgaattaaggatacgcca
ataaagactgaagactatattaattattctttatattttgaagccaaaacatttttgcat
ggattgctcgtagttgaagacaaactaagtatggcgcacggacttgaaactcgggtacct
tgtcttgacaatgatttcgttgattttgctttacaggtgcctgtgaaatataagctatct
gatttcgcgtttgaaagggtcaatgaaaacgacacattctctaaacgagaaaaaaggatg
aatggtaaaaaaatcttacgtaaaatgatgagtcgctatgtgcccgataacgtcgctcat
gctccgaagcaaggattctcggcaccggatgccagttggttcaaaggagaaagtatcgaa
tttgtgcgctcgttgcttggtgatagaaatgctaaaattttcgaattactcgattattca
gtcgtgaaccatttggtgaatgaccacattcaaaaccatcacaatcaccgattattaatt
tggtcactaatttattttgaaatttttatgcaggttcatttgtctaagggtcataaatct
aattatcatttgtttacgccagaaacggtggagctttaa

DBGET integrated database retrieval system