KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_0914Help
Entry
CBUD_0914         CDS       T00583                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd00040  Pentose and glucuronate interconversions
cbd00052  Galactose metabolism
cbd00500  Starch and sucrose metabolism
cbd00520  Amino sugar and nucleotide sugar metabolism
cbd01100  Metabolic pathways
cbd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBUD_0914 (galU)
   00052 Galactose metabolism
    CBUD_0914 (galU)
   00500 Starch and sucrose metabolism
    CBUD_0914 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CBUD_0914 (galU)
Enzymes [BR:cbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CBUD_0914 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABS78136
UniProt: A9KFK3
Position
906160..907047
Genome map
AA seq 295 aa AA seqDB search
MKKVTTAVFPVAGLGTRFLPVTKAGPKEMLPIVDKPIIQYVVEEAIAAGITHLVFVTSSS
KRAIEDYFDSNYELETRLRSSRKLDALKLIQNLLPKEVRISYVRQAHPLGLGDAVLSAKH
VVGDQPFAVLLPDDIIDCGEKSCLQLMMEAFEKHQRNIIAVEQVPLNQTDKYGIVSVVDE
HQVKRITGMVEKPPLGSALSDWAVTGRYILSPRVFDHLDAISCGVGGEIQLTDAIVALLQ
EEQVLAFPFKGHRYDCGSRLGFLQATIAYALKRPEFKEPLREYLFKLLGSECVGG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtcactactgccgtttttcctgtggccggattgggaacacgattcctgccg
gtaaccaaagcggggcccaaagaaatgttgccgattgttgataagccaattattcaatat
gtagtagaagaggcgatcgctgccggcattacgcatctcgtttttgtaacgagtagcagc
aagcgggctatcgaagattattttgatagtaattatgaattggaaacgcggttgcgctcc
agtaggaaactggatgccttgaaattaatacagaatctcttacccaaagaagttcgtatt
agctatgtgcgtcaagcgcaccctttaggcttgggtgatgcggtattatcggcgaaacat
gtcgtcggcgaccagccgtttgcggtattgttacccgatgacattattgactgcggtgag
aaaagctgtttgcaattgatgatggaagcttttgaaaagcatcaacggaatatcattgcg
gttgaacaggtgcctttaaatcaaaccgataaatatggcatcgtttctgtggtggatgag
caccaggtgaagcgaattactggtatggttgaaaaacctcccctcggaagcgcgttgtca
gattgggctgttaccggccgctatattttgtctccacgtgtttttgatcatttggatgcc
atcagttgtggcgtggggggggagattcaactaacggatgcgattgtcgcgctgttgcaa
gaagagcaggtgcttgcctttcccttcaagggtcaccgttacgattgcgggagtcgattg
ggtttcttgcaggcgacgattgcttatgcgctcaaacggcctgaatttaaagagcccttg
cgggaatatttatttaaactgttgggctcggagtgcgtggggggttaa

DBGET integrated database retrieval system