KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1010Help
Entry
CBUD_1010         CDS       T00583                                 

Definition
nicotinamidase (EC:3.5.1.- 3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CBUD_1010
Enzymes [BR:cbd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CBUD_1010
    3.5.1.-  
     CBUD_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(994248..994862)
Genome map
AA seq 204 aa AA seqDB search
MKTLIILDVQNDFMAGGSLEVPNANAIIPIINNLQDKFDLIVATQDWHPANHKSFASNHP
GKKPFEKIMLHGLEQTLWPDHCVQGSVGALFHPELETRPIEAIFRKGTDPEIDSYSAFYD
NGHYKSTGLAGFLREKGARQLFFCGLCADICVYFTIKDAIAEGFICYLIEEATCPLDKVA
FKEVKTELLNNQVNIIHHKEIDND
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactcattattctcgatgttcaaaatgattttatggcaggaggctctctagaa
gttcctaacgctaacgcgatcattccaattattaataatttacaggataagtttgacttg
attgtggcgactcaagattggcaccctgctaatcacaaaagttttgcctccaatcatccc
ggtaaaaaaccctttgaaaaaattatgcttcacggcctggaacaaactttatggcctgat
cattgcgtccaaggttcggtgggcgctttattccacccggaacttgaaactcggcctatt
gaagctatcttccgtaaaggaacagatcctgaaatcgacagctacagcgctttttacgat
aacggccattataaaagcacgggactcgctggatttcttcgcgaaaaaggagcgcgtcaa
ctctttttttgtggcttatgcgcagacatttgtgtttactttacgattaaagatgctatt
gccgaaggttttatttgctacttaattgaagaggctacttgtccattggataaagtggct
tttaaagaagttaaaacagaacttttaaacaatcaagttaacattatccatcataaggaa
atcgataatgactaa

DBGET integrated database retrieval system