KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1010Help
Entry
CBUD_1010         CDS       T00583                                 

Definition
nicotinamidase (EC:3.5.1.- 3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cbd00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(994248..994862)
Genome map
AA seq 204 aa AA seqDB search
MKTLIILDVQNDFMAGGSLEVPNANAIIPIINNLQDKFDLIVATQDWHPANHKSFASNHP
GKKPFEKIMLHGLEQTLWPDHCVQGSVGALFHPELETRPIEAIFRKGTDPEIDSYSAFYD
NGHYKSTGLAGFLREKGARQLFFCGLCADICVYFTIKDAIAEGFICYLIEEATCPLDKVA
FKEVKTELLNNQVNIIHHKEIDND
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactcattattctcgatgttcaaaatgattttatggcaggaggctctctagaa
gttcctaacgctaacgcgatcattccaattattaataatttacaggataagtttgacttg
attgtggcgactcaagattggcaccctgctaatcacaaaagttttgcctccaatcatccc
ggtaaaaaaccctttgaaaaaattatgcttcacggcctggaacaaactttatggcctgat
cattgcgtccaaggttcggtgggcgctttattccacccggaacttgaaactcggcctatt
gaagctatcttccgtaaaggaacagatcctgaaatcgacagctacagcgctttttacgat
aacggccattataaaagcacgggactcgctggatttcttcgcgaaaaaggagcgcgtcaa
ctctttttttgtggcttatgcgcagacatttgtgtttactttacgattaaagatgctatt
gccgaaggttttatttgctacttaattgaagaggctacttgtccattggataaagtggct
tttaaagaagttaaaacagaacttttaaacaatcaagttaacattatccatcataaggaa
atcgataatgactaa

DBGET integrated database retrieval system