KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1015Help
Entry
CBUD_1015         CDS       T00583                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Brite
Enzymes [BR:cbd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     CBUD_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(997999..998439)
Genome map
AA seq 146 aa AA seqDB search
MKMTKEYAKQALEFLKRHEGFSPHLYKDSVSKWTIGYGRNLEDDPLHEYEAEFLLMQDIE
RLDKALSLHEAYQALDNERKAIILDMAYNLGYGGLMKFTHLWQALEKQDYEQAAKEMLNS
EWAEEVKSRATELAQLMDSSWVQNVR
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatgactaaagaatacgcaaaacaagcgctcgaattcctcaaacgacatgaaggt
ttttcacctcatctttacaaagacagcgtcagcaaatggacgatcggctatggtcggaat
ctcgaagacgatccgctgcatgaatacgaggctgaatttttacttatgcaagacatcgaa
cgccttgataaggcgctatcacttcacgaagcttatcaagcgcttgataacgaacgaaaa
gccatcatcctcgacatggcctataacttaggctatggaggattaatgaaattcacccat
ctgtggcaggcactagaaaaacaagactatgaacaagctgcgaaggaaatgcttaatagt
gaatgggccgaagaagtgaaaagccgagcgactgaattggcccaattgatggattcttct
tgggttcaaaatgtgcgctga

DBGET integrated database retrieval system