KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1153Help
Entry
CBUD_1153         CDS       T00583                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd01040  Biosynthesis of unsaturated fatty acids
cbd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CBUD_1153
Enzymes [BR:cbd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CBUD_1153
Lipid biosynthesis proteins [BR:cbd01004]
 Desaturase
  First
   CBUD_1153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase FA_hydroxylase Spc7 JIP_LZII
Motif
Other DBs
NCBI-ProteinID: ABS78058
UniProt: A9KCM2
Position
complement(1127097..1128212)
Genome map
AA seq 371 aa AA seqDB search
MKQISKINWLNVSFIILTGLVGITGTILFIVFGLVHWPTWVLAGAMLIACGLSITAGYHR
LAAHKSYKAAWPIRLFFALFGAAAFEGSIVEWATDHRKHHRYTDTDQDPYSIKKGFWYAH
IGWLFTLDPSKRDFSNVQDLLDDPIYRFQHRFFPIIAILMGFGLPMAIGALWGDPLSALV
IAGALRITVVYQMTFFINSLCHMIGKQTYKNSSARDNWVTALLTMGEGFHNFHHQFPIDY
RNGVRFFHFDPTKWLIYLLSRMGLVSGLKRVEQRRIIKYRLQTDTQRLALLSAERVEVVK
PLYERIHHLLGRLEELEKSYLALKEAQFKAYKNRLREIRQKLKATERELRTFLTLWSKVA
RPLQTCQLSGS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatttcaaaaatcaactggttaaacgtctcgtttatcattcttacagggctt
gtaggaatcactggtaccatacttttcatcgtttttggccttgttcattggccgacgtgg
gttttggcgggggcgatgcttattgcttgcggtctttcgataacagcgggttaccaccgc
cttgccgctcataaaagctacaaggcggcatggcctattcggttattttttgcgcttttt
ggagcggcggcttttgaaggaagtattgtagaatgggccactgaccatcgaaagcatcac
cgttataccgacacagaccaagatccctacagcatcaaaaaaggcttttggtatgcccac
ataggatggctatttacgcttgatccttcaaaacgggattttagcaatgtccaagatttg
ctggatgatcctatctatcgctttcaacatcgtttctttccgattattgctattctaatg
ggttttggattgccaatggccattggcgcgctttggggcgacccgctcagcgctcttgtg
attgctggcgctttaaggattacggtggtttatcagatgacgttttttattaattcactt
tgtcatatgattggcaaacaaacttacaaaaattcatctgctcgggataattgggtaacc
gccctgcttactatgggcgaaggttttcataattttcaccatcaatttccgattgattat
cgaaacggcgtgcgcttttttcactttgatccaacgaaatggttgatttatttgttatcc
cggatgggattggtgtctggcttaaagcgtgtagagcaacgcagaatcattaaataccgt
ctgcaaaccgatactcaacgtttggcactgctttcagcagaaagagtagaggtcgtaaaa
ccgctttatgagcgcattcatcacttgttagggcggctggaagaacttgaaaagagttat
ttagcattgaaagaggcgcaatttaaggcttataaaaaccgactccgagaaatacgacaa
aagctaaaagcaacggagcgcgagcttcgaactttcttaactctgtggagcaaggtggcc
cggccgcttcagacttgtcaacttagtggatcataa

DBGET integrated database retrieval system