KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1253Help
Entry
CBUD_1253         CDS       T00583                                 

Gene name
trpBF
Definition
bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta (EC:5.3.1.24 4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cbd00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cbd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1233229..1235031
Genome map
AA seq 600 aa AA seqDB search
MIEQPLIKICGIKDSALASKAVQMGADFIGIITYSKSKRYVNNKMAQNLAKAIRKAGGRP
VAVFVDFSAKAMESFCKSTGIDVVQLHGAISKAEHHLLPASLQRIYVLSVNKNGSILKDD
AGGLEHLDEKRDFLLFDNEIGGSGQSYDLNQFNYTGKFRYFLSGGLSPTNVNRAIQLTKP
QGVDVSSGVEDSNGNKKLTLIQSFITNVRKNPAGRFGTFGGCYVAETLMAPLQELQESMT
RIVKSNVFQTTFHDILQHYAGRPTPLTEAKRLSDFIQGPRIFLKREDLLHTGAHKINNAL
GQCLLAKKLKKTRIIAETGAGQHGVASATACAYFDLRCDIYMGAEDMKRQAPNVERMKLL
GANVIPVLAGSQTLKDAVNEALRDWSASYENTHYCLGSALGPHPFPEMVALFQSVIGKEA
KTQVHEQTGKQPDAIIACVGGGSNAIGIFSAFIDDPTVRLIGVEAGGKGNQLGEHAARIK
HQRKGVLHGTYTYLLQDENGQIAKTHSISAGLDYPAIGPQHAFLFETGRAIYTSVSDKDA
LTAFKLLAKTEGIIPALESSHAIAYLLKEGRKKFSRKDIVIVNLSGRGDKDIPALKEYSL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagcccttgattaaaatctgcggtataaaagattcggcactggcaagcaaa
gccgttcaaatgggagcggattttattggtatcattacctattcaaaatcaaaacgttat
gtaaataataaaatggctcaaaatcttgcaaaagctattaggaaagcaggcggcagaccc
gttgctgttttcgttgatttttcagcaaaagccatggaatctttttgtaagtccacggga
atcgatgtcgtgcagttacatggcgctatttcaaaagccgaacatcatctattgccagca
tcattgcaacgcatttatgttctctccgttaataaaaacgggtcgattttaaaagacgac
gccggagggcttgagcatctagatgaaaaaagggattttcttttatttgataatgaaatt
ggcggaagtggccaatcctacgacctgaatcaatttaattatactggaaaattccgttac
tttttatcgggcggtctgtctcctacgaatgtaaatcgcgcaattcaattaacaaaacca
cagggcgtagacgtttccagtggtgttgaagatagtaacggcaataagaagttaacgctt
atccaatcttttattaccaatgtccgaaaaaatccggcagggcgctttggcacttttggc
ggttgctatgtcgctgaaactttaatggctcccctacaagaattacaagaatccatgacg
cgcattgtaaaatcaaacgtctttcaaaccacttttcacgatattttacaacattacgcg
ggtcgtccaacgccattaacggaagcaaaacgattgagtgattttattcaaggtccgcgt
atttttttaaagcgcgaagatttattacataccggcgcacacaaaataaataatgccttg
ggacaatgtttgctggctaaaaaactgaaaaagactcgcatcatcgctgaaaccggcgcg
ggacagcacggggtggcgagtgcaactgcctgtgcttattttgatttgcgttgcgatatt
tatatgggcgccgaggatatgaaacgccaagcgcctaatgtagagcgaatgaagttatta
ggcgccaacgtgattcccgttttagctggatcacaaacattaaaagacgctgtcaacgaa
gcattacgtgattggtccgccagttatgaaaatacccactattgtttagggtcagcgcta
ggtccgcatccttttcctgaaatggtggctctttttcagtctgttattggtaaagaagcc
aaaactcaagtccatgaacaaacgggaaaacaacctgatgctattatcgcctgcgttggt
ggcggttcaaatgcgattggtattttttcagcgtttattgacgatccaaccgtaaggtta
attggcgttgaagcgggtggtaaaggcaaccaactgggcgagcatgccgcgcggattaaa
caccaacgcaaaggcgttctgcatggcacttatacttatcttttacaagatgagaatggc
caaattgcgaagacgcactctatttcggctggcttggattacccagcgatcgggccacaa
catgctttcctttttgaaacgggtcgggccatttataccagcgtcagcgataaagacgca
ttaaccgcatttaaattattagcaaaaacggagggcattattccagcgctggagtcatct
cacgcgatagcttatttattaaaggaaggaaggaaaaaattttcgcgaaaagacattgtc
atcgtcaatttatcagggcgcggcgacaaagatattcctgcactcaaggagtatagttta
taa

DBGET integrated database retrieval system