KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1253Help
Entry
CBUD_1253         CDS       T00583                                 

Gene name
trpBF
Definition
(GenBank) N-(5'-phosphoribosyl)anthranilate isomerase
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd00260  Glycine, serine and threonine metabolism
cbd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbd01100  Metabolic pathways
cbd01110  Biosynthesis of secondary metabolites
cbd01130  Biosynthesis of antibiotics
cbd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CBUD_1253 (trpBF)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CBUD_1253 (trpBF)
Enzymes [BR:cbd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CBUD_1253 (trpBF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CBUD_1253 (trpBF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PRAI
Motif
Other DBs
NCBI-ProteinID: ABS78259
UniProt: A9KE94
Position
1233229..1235031
Genome map
AA seq 600 aa AA seqDB search
MIEQPLIKICGIKDSALASKAVQMGADFIGIITYSKSKRYVNNKMAQNLAKAIRKAGGRP
VAVFVDFSAKAMESFCKSTGIDVVQLHGAISKAEHHLLPASLQRIYVLSVNKNGSILKDD
AGGLEHLDEKRDFLLFDNEIGGSGQSYDLNQFNYTGKFRYFLSGGLSPTNVNRAIQLTKP
QGVDVSSGVEDSNGNKKLTLIQSFITNVRKNPAGRFGTFGGCYVAETLMAPLQELQESMT
RIVKSNVFQTTFHDILQHYAGRPTPLTEAKRLSDFIQGPRIFLKREDLLHTGAHKINNAL
GQCLLAKKLKKTRIIAETGAGQHGVASATACAYFDLRCDIYMGAEDMKRQAPNVERMKLL
GANVIPVLAGSQTLKDAVNEALRDWSASYENTHYCLGSALGPHPFPEMVALFQSVIGKEA
KTQVHEQTGKQPDAIIACVGGGSNAIGIFSAFIDDPTVRLIGVEAGGKGNQLGEHAARIK
HQRKGVLHGTYTYLLQDENGQIAKTHSISAGLDYPAIGPQHAFLFETGRAIYTSVSDKDA
LTAFKLLAKTEGIIPALESSHAIAYLLKEGRKKFSRKDIVIVNLSGRGDKDIPALKEYSL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagcccttgattaaaatctgcggtataaaagattcggcactggcaagcaaa
gccgttcaaatgggagcggattttattggtatcattacctattcaaaatcaaaacgttat
gtaaataataaaatggctcaaaatcttgcaaaagctattaggaaagcaggcggcagaccc
gttgctgttttcgttgatttttcagcaaaagccatggaatctttttgtaagtccacggga
atcgatgtcgtgcagttacatggcgctatttcaaaagccgaacatcatctattgccagca
tcattgcaacgcatttatgttctctccgttaataaaaacgggtcgattttaaaagacgac
gccggagggcttgagcatctagatgaaaaaagggattttcttttatttgataatgaaatt
ggcggaagtggccaatcctacgacctgaatcaatttaattatactggaaaattccgttac
tttttatcgggcggtctgtctcctacgaatgtaaatcgcgcaattcaattaacaaaacca
cagggcgtagacgtttccagtggtgttgaagatagtaacggcaataagaagttaacgctt
atccaatcttttattaccaatgtccgaaaaaatccggcagggcgctttggcacttttggc
ggttgctatgtcgctgaaactttaatggctcccctacaagaattacaagaatccatgacg
cgcattgtaaaatcaaacgtctttcaaaccacttttcacgatattttacaacattacgcg
ggtcgtccaacgccattaacggaagcaaaacgattgagtgattttattcaaggtccgcgt
atttttttaaagcgcgaagatttattacataccggcgcacacaaaataaataatgccttg
ggacaatgtttgctggctaaaaaactgaaaaagactcgcatcatcgctgaaaccggcgcg
ggacagcacggggtggcgagtgcaactgcctgtgcttattttgatttgcgttgcgatatt
tatatgggcgccgaggatatgaaacgccaagcgcctaatgtagagcgaatgaagttatta
ggcgccaacgtgattcccgttttagctggatcacaaacattaaaagacgctgtcaacgaa
gcattacgtgattggtccgccagttatgaaaatacccactattgtttagggtcagcgcta
ggtccgcatccttttcctgaaatggtggctctttttcagtctgttattggtaaagaagcc
aaaactcaagtccatgaacaaacgggaaaacaacctgatgctattatcgcctgcgttggt
ggcggttcaaatgcgattggtattttttcagcgtttattgacgatccaaccgtaaggtta
attggcgttgaagcgggtggtaaaggcaaccaactgggcgagcatgccgcgcggattaaa
caccaacgcaaaggcgttctgcatggcacttatacttatcttttacaagatgagaatggc
caaattgcgaagacgcactctatttcggctggcttggattacccagcgatcgggccacaa
catgctttcctttttgaaacgggtcgggccatttataccagcgtcagcgataaagacgca
ttaaccgcatttaaattattagcaaaaacggagggcattattccagcgctggagtcatct
cacgcgatagcttatttattaaaggaaggaaggaaaaaattttcgcgaaaagacattgtc
atcgtcaatttatcagggcgcggcgacaaagatattcctgcactcaaggagtatagttta
taa

DBGET integrated database retrieval system