KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1255Help
Entry
CBUD_1255         CDS       T00583                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd00260  Glycine, serine and threonine metabolism
cbd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbd01100  Metabolic pathways
cbd01110  Biosynthesis of secondary metabolites
cbd01130  Biosynthesis of antibiotics
cbd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CBUD_1255 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CBUD_1255 (trpA)
Enzymes [BR:cbd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CBUD_1255 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB Fe_dep_repress HTH_10
Motif
Other DBs
NCBI-ProteinID: ABS77457
UniProt: A9KE95
Position
1235048..1235851
Genome map
AA seq 267 aa AA seqDB search
MNRIEQQFKKSPAYVAYLTAGDGGLERSLESLLALAKGGVNILEVGVPFSDPVADGPVIQ
EASIRALAQGTTLHDVLTLITSFRQHSEIPIILFTYFNPLLAAGDKIYQQMKSAGVDGCL
VVDLPVEEAAPHLTACKTAKIAPILLISPSTTQERLKKINEHGEGMLYYVCRPGTTGVRA
TLPENFPAKMNQIKSMTSLPIVTGFGIANRKMAAQALQYADGFVIGSLFVKAIAEGISKN
ALTRLAQSLNPHYPNLRLITPFRKKTF
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcattgaacaacaatttaaaaagtctcctgcttatgtcgcttatttaacggcc
ggcgacggtggactggagcgttcgttagaaagtctattggctttagcaaaaggcggcgtt
aatattttagaagttggcgtcccgttttctgaccctgttgctgacgggccggtgattcaa
gaagccagcatccgtgcgctggctcaaggcactactttacacgacgtattaacgttaata
acgtcgtttagacaacacagtgaaattcccattattttatttacttattttaatcccctc
ttagcagccggcgataaaatttatcaacagatgaaatcggctggtgtggacggttgttta
gtcgttgatttacctgtagaagaagcagccccgcacctcactgcttgcaaaaccgcaaaa
attgctccaattttattaatctcaccctccacgacgcaagagcgtttaaaaaaaattaat
gagcacggagaaggaatgttgtattacgtatgccgacctggaacaaccggcgttcgagcc
accctgcctgaaaattttcccgctaaaatgaatcaaataaaatcaatgacgagcctaccc
atcgttaccggtttcggcatcgctaatcgaaaaatggccgcccaagcgttgcagtacgct
gacggttttgtaatcggttcgttatttgtaaaagcaatcgcagaaggaatcagcaaaaac
gcattaactcgtcttgcacaatcgctcaacccgcattaccccaacctacggctcatcacc
ccttttagaaaaaagaccttttag

DBGET integrated database retrieval system