KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1256Help
Entry
CBUD_1256         CDS       T00583                                 

Definition
sterol delta-7-reductase (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    CBUD_1256
Enzymes [BR:cbd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     CBUD_1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1236674..1238041
Genome map
AA seq 455 aa AA seqDB search
MTPEVQHNASYRLLRYSLFPLFLITVCPPAAIIMWYTNVALNGSLTALAVLFTQKGFFTT
LYQIWSPVFFGTREAWFIISIFMITQLLLMRIVPGKRFEGPITPKGNVPVYKANGVLCFG
ITLTLFYLCAYQFRWFPPTIVYDHFGGILGALNIFSLIFCFILYFKGRFAPSTSDHSLSG
NFIFDYYWGTELYPRILGWDIKMFTNCRFGMMGWPIIILSFAAKQNQLYGLSNSMLVALL
IQLVYIGKFFWWERGYLRSLDIMHDRAGFYICWGCLVWVPSIYTSPLLYLVNHPIPLSWF
SADIILFLGVGCVFINYFADAQRQKVRASNGNCKIWGKKPALIRATYTTEQGKQKQTVLL
ASGWWGISRHFHYLPEIGAAFLWTVPALFSHFLPYFYVVYLTILLTHRSLRDENRCHKKY
GPDWEIYCQQVPSRIIPYFLTKRFNAMVKWRKSAN
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggaagtgcagcacaacgcgtcttatcgattattgcgttattctttgtttcca
cttttcttaattaccgtctgcccgcctgccgctattattatgtggtacacgaacgtcgct
ttgaatggttccttaacagcgctagctgttcttttcacgcagaaaggattttttaccact
ctttatcagatctggagtcctgtcttttttggcacgcgagaagcttggttcattattagt
atctttatgatcactcaattgttactcatgcgaatagtccctgggaaacgtttcgagggt
cctatcacaccaaaagggaacgttcctgtctacaaagcgaatggggttttatgctttggt
attacgttgacgttattttacctttgtgcttatcaatttcgatggtttccgccgactatt
gtttacgatcattttggcggtattttaggtgcgttaaatatttttagtttaattttttgt
ttcattctttatttcaaagggcgttttgcaccctccacttccgatcatagtctaagcggt
aattttatttttgactattattggggaaccgaactatatccccgcattcttggatgggat
atcaaaatgttcaccaactgccgtttcggaatgatggggtggccgattattatcttgtca
tttgctgcaaaacaaaatcaattgtatggattaagcaattcgatgttagttgcgctattg
attcagttagtttatatcgggaaatttttttggtgggagagaggttatttgcgttcattg
gatatcatgcacgatcgagccggtttttatatctgttggggatgtttagtgtgggtcccg
agcatttatacttctcctctcttatatttagttaatcatcccattcccttaagctggttc
agtgcagatataattttatttttgggggtcgggtgtgttttcattaattattttgccgat
gcgcagcgccaaaaagttagagcctctaacggtaattgtaaaatttggggcaaaaagcct
gccctcattcgggccacttacacaacggagcaaggtaagcaaaagcaaacggtgttactg
gcttcgggctggtggggaatttctcggcattttcattacctcccggaaataggcgctgct
tttttatggacagtacctgcattattttcacattttttgccctatttttatgtagtttat
ttaactattttacttacgcatcgttcgctacgcgatgagaatcgttgccataaaaaatac
ggccccgattgggaaatttactgccaacaggtaccctctcggataattccttatttttta
actaaaagattcaatgctatggtaaaatggcgaaaatctgcaaattaa

DBGET integrated database retrieval system