KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1466Help
Entry
CBUD_1466         CDS       T00583                                 

Gene name
cysQ1
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7 3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CBUD_1466 (cysQ1)
Enzymes [BR:cbd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CBUD_1466 (cysQ1)
Transfer RNA biogenesis [BR:cbd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CBUD_1466 (cysQ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1462677..1463492)
Genome map
AA seq 271 aa AA seqDB search
MDDDWLKPLVLLAKKAGAEILKYFGLSKEDLHVMQKEDRTPVTEADLSAHKILQKGLTAL
TPTIPILSEEGKIPPYAERQKWDRYWLLDPLDGTRGFIENRDEFTVNIALIERHEPVMGV
VYAPVFDLCYFASRGQGAFKQVAEETPISIQTRKMDEDSFSVLLGQYLRSPRLPELFNAI
SGCEIVRLNSSLKFCWIAEGKGDLYPRLGDTSEWDTGAGHCVLNEAGGAILELNGKELRY
NEKNSLMNPAFVAIGDVAQKEKVFELLERTP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtggacgatgattggttaaaaccccttgttttattggcaaaaaaagccggtgctgaaatt
ttgaaatatttcggattgtctaaagaagacctgcatgtcatgcaaaaagaagaccgaaca
ccggttaccgaggccgatctttccgcgcataaaattctccaaaaagggctaaccgcgtta
acgccgactattccgattttatcggaagaagggaagattcccccttacgccgagcgtcag
aaatgggaccggtattggttattagatcctttagatggtacgcgaggatttatagagaat
cgtgatgaattcaccgttaatatcgctttaattgagcgacacgagcccgtgatgggtgtg
gtttacgcgcccgtatttgatttatgttacttcgcctctcgcggacaaggtgcttttaag
caagttgccgaagaaacacccatctctattcaaacgaggaagatggacgaagattcgttt
tctgttttattgggccaatacttacgctcgccccgcctcccggagctatttaacgctatc
tctggttgtgagatcgttcgattaaacagttctttaaaattttgttggatcgcggaagga
aaaggcgatttgtaccctcgccttggcgacaccagtgaatgggatacgggggcaggtcat
tgcgttctaaacgaggcaggcggtgcgatccttgagttaaatgggaaagaattgcgatac
aacgagaagaattcccttatgaatccagcctttgtagcgatcggggatgtggctcaaaaa
gagaaagtattcgaattactcgaaagaactccataa

DBGET integrated database retrieval system