KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1487Help
Entry
CBUD_1487         CDS       T00583                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd00071  Fatty acid degradation
cbd00280  Valine, leucine and isoleucine degradation
cbd00281  Geraniol degradation
cbd00310  Lysine degradation
cbd00362  Benzoate degradation
cbd00380  Tryptophan metabolism
cbd00410  beta-Alanine metabolism
cbd00640  Propanoate metabolism
cbd00650  Butanoate metabolism
cbd00903  Limonene and pinene degradation
cbd00930  Caprolactam degradation
cbd01040  Biosynthesis of unsaturated fatty acids
cbd01100  Metabolic pathways
cbd01110  Biosynthesis of secondary metabolites
cbd01120  Microbial metabolism in diverse environments
cbd01130  Biosynthesis of antibiotics
cbd01200  Carbon metabolism
cbd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CBUD_1487
   00650 Butanoate metabolism
    CBUD_1487
  Lipid metabolism
   00071 Fatty acid degradation
    CBUD_1487
   01040 Biosynthesis of unsaturated fatty acids
    CBUD_1487
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBUD_1487
   00310 Lysine degradation
    CBUD_1487
   00380 Tryptophan metabolism
    CBUD_1487
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBUD_1487
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CBUD_1487
   00281 Geraniol degradation
    CBUD_1487
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBUD_1487
   00930 Caprolactam degradation
    CBUD_1487
Enzymes [BR:cbd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CBUD_1487
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CBUD_1487
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CBUD_1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 NAD_Gly3P_dh_N AlaDh_PNT_C ApbA Pyr_redox_2 Methyltransf_12 DLH Gmx_para_CXXCG
Motif
Other DBs
NCBI-ProteinID: ABS77810
UniProt: A9KCN5
Position
complement(1480617..1482668)
Genome map
AA seq 683 aa AA seqDB search
MKWQRGSKMRELQTYKHWKIKTDKDGILWLTLDREDTSVNSMNREVFTEFNKVLDEIAAQ
NPIAVILQSGKKKGFIAGADIKQFTDLKNKNEAFDLIRQAQLVLDKLEALPMPTVAMISG
FCLGGGLEVALACRYRVAEDNESTLIGLPEVKLGIHPGWGGTVRLPKLIGAPKAMEIMLP
GAAVPARKAAKLGMVDAAVPLRNLENAARYFALQKPPVHKPKGWEKYTNVSYIRPWLGRL
FYKKLSAKVEKTHYPAPYAIVHNWIKEGVGKEAYFTEAQSIAQLMMTESSRNMVRLFFLR
ERLKSLAKKTRYLPQQIHVIGAGVMGGDIAAWCALRGIRVTLHDKSAEKIAPAIKRAHAL
YEKKLKIPRLIQAAMDRLEPDVEGTGVKKADLIIEAVFEDIKVKQEVLSAIEPQLKPEAI
LATNTSSLSLDELSSVLKNPERLVAIHFFNPVAKLPLVEVASSQQTSADIAEKALAFVGA
IDKLPLAVSSSPGFLVNRALMAYLLEANRCLDEGFSMEQIDKAATDFGMPIGPIELADRI
GLDICLSVAQHLKNFYKHAEVSERLKTLVKEGHLGAKTGQGFYHYQNGRRVESKSTAEST
NPDLTDRLILQLVNEVKKCLDEKVIDKEDLADAGIVFGTGFAPFRGGPMQYAKSRGEADV
VKTLKRLAKQYGERFLPSEGWSA
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatggcagcgagggagtaaaatgcgggaattacaaacttacaaacactggaaaata
aaaaccgataaagatggtattctttggttaaccctcgaccgtgaagatacatcggtaaat
tcaatgaatcgggaagtttttactgaatttaataaagtgctcgatgaaattgctgctcaa
aatcccatagccgttatccttcaatcaggaaagaaaaaaggattcatcgccggtgcagac
atcaaacaatttaccgatttaaaaaacaaaaatgaagcctttgatttaatccgccaagcg
cagctcgtccttgataagctcgaagcgctgcccatgccaaccgtagcgatgattagcgga
ttttgtttaggcggcggtttggaagtggcgcttgcctgtcgctatcgagtggcggaagat
aatgaatccacgctgattggattacccgaagtgaaattgggtattcatccagggtggggt
ggtaccgttcgattgcctaaattaatcggcgcgccgaaagcaatggaaattatgctgcca
ggtgcagcagttccggcgagaaaagctgctaagcttgggatggttgacgccgcagtaccg
cttcgtaatttagaaaatgccgctcgttatttcgctttgcaaaagccccccgtccataaa
ccgaaaggatgggaaaaatacacgaatgtaagttatattcgcccgtggttagggcggtta
ttttataaaaaactctctgcaaaagtggaaaaaacgcattacccggcgccatacgccatc
gtccataattggatcaaagagggggttggcaaagaagcctacttcacagaagctcagtcg
atcgcgcaattaatgatgaccgagagcagtcgcaacatggtgcgactgttttttttaaga
gaacgcttgaagtcgctcgctaaaaaaacgcgctatctgccgcaacaaattcacgttatt
ggcgctggtgtgatgggcggcgatattgcagcttggtgtgcgcttcgcggcatccgcgtg
actttacacgataaatcagcggaaaaaattgcgccggcgataaagcgggcgcatgctctt
tatgaaaaaaaattaaaaatcccgcgcttaattcaggcagcgatggaccgattagagccg
gatgtggaaggaacgggcgttaaaaaagcggatttaattattgaagctgtttttgaggat
ataaaagtaaagcaggaagttttaagtgctatcgaaccgcaattaaaacccgaggctatt
ttagcgactaacacgtccagtctttctttagatgaattaagttcggtgttaaaaaaccct
gagcgcttagtggctattcattttttcaatcccgttgctaaattaccgttggttgaagtg
gcaagcagtcagcagacatcggcggacattgctgaaaaagcgttagcgttcgtgggagct
attgataaattgccgttggcggtgagcagcagtccaggatttttagtcaatcgggcatta
atggcttatttattagaagcgaaccgttgtttagacgaagggttttccatggaacaaatt
gataaagcggcaactgattttgggatgcccataggtccgatcgagctagctgatcggatt
gggttagacatatgtttgtctgttgctcaacatctgaaaaacttttacaagcatgccgaa
gtttcagaacgattaaaaacattggttaaggaaggtcatctaggcgctaaaacgggtcaa
gggttttatcattatcaaaacggaagacgtgttgaatcaaagtctacagccgaatcaacg
aatcctgatttaaccgaccggttaatattgcaactcgttaatgaagtcaagaaatgtttg
gatgagaaagtgattgacaaggaagatttagccgatgcagggatcgtatttggcacgggg
tttgcaccgtttcggggtggaccgatgcagtatgccaagagtcgtggagaggccgatgtc
gtgaaaactttaaaacgcttagcaaaacaatacggtgaacgatttttgcctagcgaagga
tggtccgcatga

DBGET integrated database retrieval system