KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1562Help
Entry
CBUD_1562         CDS       T00583                                 

Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBUD_1562
   01230 Biosynthesis of amino acids
    CBUD_1562
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBUD_1562
   00030 Pentose phosphate pathway
    CBUD_1562
   00051 Fructose and mannose metabolism
    CBUD_1562
  Energy metabolism
   00680 Methane metabolism
    CBUD_1562
Enzymes [BR:cbd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CBUD_1562
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CBUD_1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1567708..1568856)
Genome map
AA seq 382 aa AA seqDB search
MEITLSAIKADVGSIGGHTQPSIEMLQAVQQSLQKNIDSGLLIDGLVTFTGDDIAIICSH
QQGLNNEDVHVGFARQAFLAATEVAKEQGNYGAGQDLLVDAPSGNVRGAGPGVAEIEFTL
NPKSNYRPAESFMIFAGDKCAPGAFNLPLYLVFCDPMHNGGILLNPKIHLGWVFTVIDMD
YKGEDEDRIIQLSVPERSWDVAALLQNPDRYAVESIRSRYKPEEQVVSVSATRLHNIAGK
YTGKDDPIAIIRSQGIFPAPEEIIEPYSTINQIISGDARGSHNMPQLPVPINTPVTGPYC
HPLISALGFSMNKQGKFAGRYVDFFAGSAWDYARYVSQRRAAEIRRQGFMGIAMAQEAEI
AYTGLVDTWKKLDDEFELRKNG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaccttaagcgctattaaagccgatgtgggcagtatcggcggtcacacccaa
cctagcattgaaatgctacaggctgttcagcaatcccttcaaaagaatatcgactccgga
ttattgatcgatggattggtaactttcactggcgatgatattgcgattatttgttcacat
caacagggtttaaataatgaagacgttcatgtcggttttgcgcggcaagcttttcttgca
gcaactgaagtggcgaaagagcaaggcaattacggcgctggccaggatttactcgtggat
gcgccttctggcaatgttcgaggcgctggacctggtgttgctgaaattgaatttaccctt
aatccaaaatccaattaccgtccggctgaatcctttatgatatttgcaggcgataagtgc
gcacccggcgcatttaatcttcctctttatttagttttttgtgatccgatgcataatggg
ggaattttattaaatccaaaaatacatttaggctgggtgtttacggtgattgatatggat
tacaaaggggaagacgaagatcgtattattcagctttctgttcccgaacgctcctgggac
gttgccgcgttgttgcaaaatcccgatcggtatgcggttgaatccattcgctcacgttat
aaacctgaagaacaagtggtttctgtttctgccacgcgattgcataacattgcaggaaaa
tacacaggcaaggatgatccaattgctattattcgcagtcaaggtatttttccggcacct
gaggaaattattgagccgtattcgactattaatcaaattatcagcggcgatgcgcgcggc
tctcataacatgccgcaattaccggttcctattaatacgcctgttactggaccgtattgt
catcccctaatttcggcacttggtttttccatgaataagcagggtaaatttgctggacgt
tatgtggatttttttgcgggttctgcttgggattacgcgcgttatgtttcccagcgtcga
gcggccgaaattaggcggcaaggatttatgggcatcgctatggcgcaggaagcagaaatt
gcctacactggattagtagatacgtggaaaaaactggatgacgaatttgaattgcgaaaa
aatggataa

DBGET integrated database retrieval system