KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1733Help
Entry
CBUD_1733         CDS       T00583                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBUD_1733 (xylA)
   00051 Fructose and mannose metabolism
    CBUD_1733 (xylA)
Enzymes [BR:cbd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     CBUD_1733 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1730964..1732274
Genome map
AA seq 436 aa AA seqDB search
MKTYFKPIDKINYEGPDSENPLSFHYYDPQRIVLGKSMEEHLRMAVCFWHTFCWEGNDNF
GAGVFNREWLKEKKPMKRAKQRVLAAFEFFEKLGLPFFTFHDRDVSPEGDSLKETIKNFK
KIAELIAKEMERTGVQLLWGTANLFSHPRYLAGAATNPDPNVFAHAVAQVKTALDITQQL
NGKNYVLWGGREGYETLLNTDLKQELDQFGRFLSLLVDYKHKIGFNGLLLIEPKPCEPTK
HQYDFDVATVYAFLQRYGLEKEFKVNIEANHATLAGHSFAHEIAYACANDIFGSVDANRG
DPQLGWDTDQFPIDLQETVLVLYLILKHNGFTSGGFNFDAKLRRQSLDLEDLFYAHISGI
DTLARGLLIAATIIENDKLKTTKEKRYQAWKEPLNANMLSGKLDFETIAKRALDNNLDPK
PTSGEQEKLERWLSER
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatacttcaagcctatcgataagatcaattacgaagggcccgactcggagaat
ccgctaagcttccattactacgaccctcaacggatcgtacttggaaaatcgatggaagaa
catttgcgtatggcggtttgtttttggcataccttttgctgggaaggcaatgataatttt
ggtgctggcgtttttaaccgcgaatggttgaaagaaaaaaaaccaatgaaacgcgccaaa
caacgcgttcttgctgcttttgaattttttgaaaaactgggtctgcctttttttactttt
catgatcgcgacgtttcacccgaaggtgattctctcaaagaaacgattaaaaattttaaa
aaaatcgctgagctcattgccaaagaaatggaacgcacgggcgttcaattattatggggg
acagccaatttattttcccatccacgctatctcgcaggcgctgctactaatcccgatccg
aatgtcttcgcccacgcggtggcgcaagtaaaaacggctcttgatattacacagcaactg
aacggaaaaaattatgtcttatggggcggtcgcgaaggttatgaaacgttgttaaatacg
gaccttaaacaagagctcgatcaattcggccgatttctaagtttattagtcgactataaa
cataaaattggctttaacggccttttattaattgaacctaaaccttgtgagccaactaag
caccaatacgattttgatgtggcaactgtgtatgcctttttacaaaggtacggattagaa
aaagaatttaaagtcaatatcgaagccaaccacgcgacattagcgggccatagttttgct
catgaaattgcctacgcttgcgctaatgacattttcggcagcgttgacgccaaccgcggc
gatccgcaattgggttgggacaccgaccagttcccgattgatcttcaagaaacggtatta
gttctttacctgattttaaagcacaacggtttcaccagcggtggatttaattttgatgca
aaactacgacgccaaagcctcgacttagaagatctattctatgcacatattagtggcatc
gacaccctagcccgcggcttgctcatcgccgctacaataatcgaaaacgataaattaaaa
acaacaaaagaaaaacgttatcaagcttggaaagaacccttaaatgctaatatgctgagc
ggcaaacttgattttgaaaccattgcaaaaagagcccttgacaataatcttgaccccaaa
ccaacatcaggcgaacaagaaaagctcgaacgctggttgagtgaacggtaa

DBGET integrated database retrieval system