KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1738Help
Entry
CBUD_1738         CDS       T00583                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBUD_1738 (pfkA)
   01230 Biosynthesis of amino acids
    CBUD_1738 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBUD_1738 (pfkA)
   00030 Pentose phosphate pathway
    CBUD_1738 (pfkA)
   00051 Fructose and mannose metabolism
    CBUD_1738 (pfkA)
   00052 Galactose metabolism
    CBUD_1738 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CBUD_1738 (pfkA)
Enzymes [BR:cbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CBUD_1738 (pfkA)
Protein phosphatases and associated proteins [BR:cbd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CBUD_1738 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1734467..1735465
Genome map
AA seq 332 aa AA seqDB search
MQLGANVTEIKKLIVLTSGGDAPGMNAAIRAVVRTALHYQFEVYGATAGFAGLVNGQVVP
LNSRAVANCIQRGGTILKTGRFENFRFKAVRDKAREFLKKLQIDAMIVLGGNGSFAGASK
LYQEGGPQMIGIPCTIDNDIQGTDYCIGFDTACNTALQAIDKIRDTAFSHERNFLIEVMG
RSSGFIAVNVGIAGGAEIIALPEFHVDIDTLTQKIKKQHGKKSASIIVAAEANQPGHSFE
VAKQIKEKTGIEYRVCVLGHTQRGGTPTVKDRVLASLMGAQAIEALKKGLTEKMIAYQNG
KIAVAPLPDPDNGTRYFADEALLRVNNIICAM
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaggagccaacgtgaccgaaataaaaaaattaatagtgcttacttctggaggc
gatgcacctggcatgaatgctgcaatccgtgctgttgtgcgaacagcgctccattatcaa
tttgaagtttacggtgccacagccggttttgctggtttagttaacgggcaggtcgttcct
ctcaattcgcgcgcggttgccaattgcatccagcgtggcggtacaattttaaaaacgggg
cgtttcgaaaattttcgtttcaaagcagtccgtgacaaagcgcgggaatttttaaaaaaa
ttgcaaatcgatgccatgatcgttctcggcggcaacggcagttttgcgggcgcttcaaaa
ctgtaccaagaaggcggacctcaaatgattgggattccatgcactatcgataacgacatt
caaggaacggattattgcattggttttgatacggcttgtaatacagctttgcaagctatc
gataaaattcgcgatacggcattcagccacgagcgaaattttttaattgaggttatgggg
cggtcttccggttttatcgcggtgaatgtcggcatcgctggcggtgcggaaatcattgcg
ctacctgaatttcacgtcgatattgatacattgacgcaaaaaattaaaaaacaacacggt
aaaaaatcagcctccattattgtcgctgctgaagccaatcaacccggccacagctttgaa
gtcgccaaacaaataaaagaaaaaaccggcatcgaataccgcgtctgcgtcctcggccac
acccaacgcggcggaaccccaacggtaaaagatcgcgtgcttgcttctctgatgggagca
caggccattgaagcactaaaaaaaggattaaccgaaaagatgatcgcttatcaaaatggt
aaaatagctgttgcgcccctgccggatcccgacaacggaacgcgatattttgctgatgag
gccttgttaagggttaataatattatttgcgccatgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system