KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1786Help
Entry
CBUD_1786         CDS       T00583                                 

Gene name
algC
Definition
phosphoglucomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBUD_1786 (algC)
   00030 Pentose phosphate pathway
    CBUD_1786 (algC)
   00051 Fructose and mannose metabolism
    CBUD_1786 (algC)
   00052 Galactose metabolism
    CBUD_1786 (algC)
   00500 Starch and sucrose metabolism
    CBUD_1786 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    CBUD_1786 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    CBUD_1786 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CBUD_1786 (algC)
Enzymes [BR:cbd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CBUD_1786 (algC)
    5.4.2.8  phosphomannomutase
     CBUD_1786 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1782879..1784294)
Genome map
AA seq 471 aa AA seqDB search
MAAQGKINQWNVPEIVPATLFRAYDIRGPVTSEALTPGLAYAVGLSIGSEAREQGQKAIV
VGRDGRLSGPKLTAALIQGLCETGLAVLNVGLVPTPLVYFATNRLETNSGVMVTASHNPG
HHNGFKIVLNGKTLRSEEIATIRTRILERRFVKGHGAVVDVDIIEDYESYITKHIQLDRP
LKVVVDCGNGIAGKVAPALYRKLGCEVVELFCEVDGHFPNHHPDPTIPANLTDLIHKVKE
TQADLGLAFDGDADRLGIVTDKGEIIWPDRQMMLFSMDVLSRLPGSDIVFDVKCSRSLAE
IIKKYGGNPVMWRTGHSILKAKLFEIGAPLAGEMSGHIFFKDEWFGFDDGIYVGARLLRI
ISQTNQRTSEIFAELPDSVNTPELKLPMTEEKKQPFMQALLKKADFGNAKLITIDGLRVE
FEDGWGLIRPSNTSPYLILRFEADTEEKLKRIQEIFRTQLRMIDNALELPF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
ttggcagctcagggcaaaattaatcaatggaatgtccccgagatagtgccggcgacgctt
tttagagcttacgatattcgcggcccggtcacttctgaggcattgacacccggattagct
tatgccgttggcctttcgatcggcagcgaagcgcgcgaacaggggcaaaaagcgattgtc
gtgggtcgcgatgggcgtttatcagggcctaaattaacagctgctttgattcagggattg
tgtgagaccggcctggcggtgcttaatgttggtttggtgccaacgccgctggtttacttt
gccacgaatcgtttagaaaccaattccggcgtgatggtcacagcgagtcataatccgggg
caccacaatggttttaaaattgttctgaatggaaaaacattgaggtcggaagagattgca
accatccgaacgcgtattctcgaaagacgctttgttaaaggccatggcgcggtggttgat
gtggacatcattgaggattatgaatcttatatcaccaagcatattcaattagaccgcccg
ttgaaagtggtcgtggactgtggcaatgggattgccggcaaagtggcgccggcgttatat
cgcaagctagggtgtgaagtagtggagttattttgtgaggtggacggccattttcctaat
catcatcctgaccctactattcccgccaatttaacggatttaatccataaagtaaaagaa
acgcaagccgaccttgggttggcttttgatggcgatgcagatcgtttaggtattgtgacg
gataaaggagaaattatctggcccgatcgtcaaatgatgttattttcaatggacgtatta
tctcgtttaccgggttctgatattgtttttgacgtcaaatgttcgcgttccttagccgaa
ataataaaaaaatacggcggcaatcccgtcatgtggcgaaccgggcattcaattttaaaa
gctaagctttttgaaatcggcgcaccgttggccggagaaatgagcggacatatctttttt
aaagatgaatggtttggttttgatgatggcatttacgtgggagcgcgattattacgaatt
atctcgcagactaatcaacggacgagtgaaatttttgcggagttgcccgatagcgtcaac
acgcccgaattaaaattgccgatgaccgaagaaaaaaaacaaccctttatgcaagcgtta
ttgaaaaaagctgattttggaaacgcgaaacttattacaattgatggattgcgcgttgaa
tttgaagatggttgggggttaattcgaccttccaacacctcgccttatttaattttacgt
ttcgaggctgatacagaagaaaaactaaagcgtattcaggaaatctttcgaacgcagttg
cggatgattgataatgcgttggagttgcccttttaa

DBGET integrated database retrieval system